Sequence 1: | NP_001286102.1 | Gene: | Arpc2 / 35311 | FlyBaseID: | FBgn0032859 | Length: | 301 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001138986.1 | Gene: | SCRN1 / 9805 | HGNCID: | 22192 | Length: | 434 | Species: | Homo sapiens |
Alignment Length: | 261 | Identity: | 51/261 - (19%) |
---|---|---|---|
Similarity: | 84/261 - (32%) | Gaps: | 101/261 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 69 EHG---ADELLKREYGSLLTDTEEGYNVSVLINLEEIPEDCEQIAKRIGLLKRNCFASVFEKYFD 130
Fly 131 -YQEQGEEGQKRAVINYRND-------ETLYVEAKPDRVTVVFSTIFRDEDDVI--IGKVFMQE- 184
Fly 185 LREGRR-------------ASHTAPQVL----------------FSHREPPLELANTDARVG-DN 219
Fly 220 IGYVTFVLFPRHTNKETRDNTI-NLIHMFRDYLHYHIKCSKAYIHSRMRAKTSDFLKVLNRARPE 283
Fly 284 P 284 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Arpc2 | NP_001286102.1 | P34-Arc | 57..284 | CDD:397935 | 50/259 (19%) |
SCRN1 | NP_001138986.1 | Ntn_hydrolase | 38..>247 | CDD:294319 | 33/178 (19%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG4690 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |