DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arpc2 and SCRN1

DIOPT Version :9

Sequence 1:NP_001286102.1 Gene:Arpc2 / 35311 FlyBaseID:FBgn0032859 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_001138986.1 Gene:SCRN1 / 9805 HGNCID:22192 Length:434 Species:Homo sapiens


Alignment Length:261 Identity:51/261 - (19%)
Similarity:84/261 - (32%) Gaps:101/261 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 EHG---ADELLKREYGSLLTDTEEGYNVSVLINLEEIPEDCEQIAKRIGLLKRNCFASVFEKYFD 130
            |||   |:|.:...        |....:..|:.::.:         |:||.:........:....
Human   105 EHGVCIANEAINTR--------EPAAEIEALLGMDLV---------RLGLERGETAKEALDVIVS 152

  Fly   131 -YQEQGEEGQKRAVINYRND-------ETLYVEAKPDRVTVVFSTIFRDEDDVI--IGKVFMQE- 184
             .:|.|:.|      ||..|       ::.|:            .:.|||..|:  |||.:..| 
Human   153 LLEEHGQGG------NYFEDANSCHSFQSAYL------------IVDRDEAWVLETIGKYWAAEK 199

  Fly   185 LREGRR-------------ASHTAPQVL----------------FSHREPPLELANTDARVG-DN 219
            :.||.|             |.|  |::.                ||....|:| .:.|...| |:
Human   200 VTEGVRCICSQLSLTTKMDAEH--PELRSYAQSQGWWTGEGEFNFSEVFSPVE-DHLDCGAGKDS 261

  Fly   220 IGYVTFVLFPRHTNKETRDNTI-NLIHMFRDYLHYHIKCSKAYIHSRMRAKTSDFLKVLNRARPE 283
            :            .|:....|: .:::..||      |.|...|.|.....|:..:.||.:.|..
Human   262 L------------EKQEESITVQTMMNTLRD------KASGVCIDSEFFLTTASGVSVLPQNRSS 308

  Fly   284 P 284
            |
Human   309 P 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arpc2NP_001286102.1 P34-Arc 57..284 CDD:397935 50/259 (19%)
SCRN1NP_001138986.1 Ntn_hydrolase 38..>247 CDD:294319 33/178 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4690
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.