DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arpc2 and SCRN3

DIOPT Version :9

Sequence 1:NP_001286102.1 Gene:Arpc2 / 35311 FlyBaseID:FBgn0032859 Length:301 Species:Drosophila melanogaster
Sequence 2:XP_005246910.1 Gene:SCRN3 / 79634 HGNCID:30382 Length:444 Species:Homo sapiens


Alignment Length:243 Identity:54/243 - (22%)
Similarity:78/243 - (32%) Gaps:94/243 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LKPESIDIRIADFDGVLYHISNVNGDKTKVRISISLKFYKQLQE---------HGADELLKREYG 81
            |.|.::|.||         |...|.|          :.|.::||         ....|.||..|.
Human    32 LPPATVDNRI---------IFGKNSD----------RLYDEVQEVVYFPAVVHDNLGERLKCTYI 77

  Fly    82 SL----------------LTDTEEGYNV-SVLINLEEI---PEDCEQIA------KRIGLLKR-- 118
            .:                |...|.|.|. .|.|..|.:   .|.|::.|      .|:||.:.  
Human    78 EIDQVPETYAVVLSRPAWLWGAEMGANEHGVCIGNEAVWGREEVCDEEALLGMDLVRLGLERADT 142

  Fly   119 -----NCFASVFEKYFDYQEQGEEG---QKRAVINYRNDETLYVEAKPDRVTVVFSTIFRDEDDV 175
                 |....:.|||      |:.|   :.|.|.:|.|                 |.:..|.::.
Human   143 AEKALNVIVDLLEKY------GQGGNCTEGRMVFSYHN-----------------SFLIADRNEA 184

  Fly   176 II----GKVFMQE-LREG-RRASHTAPQVLFSHREPPLELANTDARVG 217
            .|    ||.:..| ::|| |..|:.........||.| ::.|...|.|
Human   185 WILETAGKYWAAEKVQEGVRNISNQLSITTKIAREHP-DMRNYAKRKG 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arpc2NP_001286102.1 P34-Arc 57..284 CDD:397935 46/212 (22%)
SCRN3XP_005246910.1 Ntn_hydrolase 25..>246 CDD:294319 54/243 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4690
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.