DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arpc2 and Scrn1

DIOPT Version :9

Sequence 1:NP_001286102.1 Gene:Arpc2 / 35311 FlyBaseID:FBgn0032859 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_081544.1 Gene:Scrn1 / 69938 MGIID:1917188 Length:414 Species:Mus musculus


Alignment Length:248 Identity:53/248 - (21%)
Similarity:85/248 - (34%) Gaps:75/248 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 EHG---ADELLKREYGSLLTDTEEGYNVSVLINLEEIPEDCEQIAKRIGLLKRNCFASVFEKYFD 130
            |||   |:|.:.....:..|:...|.:: |.:.||......|.:...:.||              
Mouse    85 EHGVCIANEAINAREPAAETEALLGMDL-VRLGLERGTTAKEALDIIVSLL-------------- 134

  Fly   131 YQEQGEEGQKRAVINYRND-------ETLYVEAKPDRVTVVFSTIFRDEDDVI--IGKVFMQE-L 185
             .|.|:.|      ||..|       ::.|:            .:.|||..|:  :||.:..| :
Mouse   135 -DEHGQGG------NYYEDAHSCHSFQSAYL------------LVDRDEAWVLETVGKYWAAERI 180

  Fly   186 REGRR--ASHTAPQVLFSHREPPLELANTDAR-----VGDNIGYVTFVLFPR---------HTNK 234
            .||.|  .:|.:.........|.|   .|.|:     .||:......|..|.         ..:.
Mouse   181 TEGVRCICNHLSLATKLDEEHPEL---RTYAQSQGWWTGDDEFNFAQVFSPADDRLDCCAGQDSL 242

  Fly   235 ETRDNTI---NLIHMFRDYLHYHIKCSKAYIHSRMRAKTSDFLKVLNRARPEP 284
            |.::.:|   .:|::.||      |.|...|.|.....|:..:.||.:.|..|
Mouse   243 EKQEESITVQTMINILRD------KASGVCIDSESFLTTASIVSVLPQNRSSP 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arpc2NP_001286102.1 P34-Arc 57..284 CDD:397935 52/246 (21%)
Scrn1NP_081544.1 Ntn_hydrolase 18..>227 CDD:412394 38/178 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4690
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.