DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arpc2 and scrn2

DIOPT Version :9

Sequence 1:NP_001286102.1 Gene:Arpc2 / 35311 FlyBaseID:FBgn0032859 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_001025287.1 Gene:scrn2 / 558306 ZFINID:ZDB-GENE-040724-75 Length:415 Species:Danio rerio


Alignment Length:258 Identity:44/258 - (17%)
Similarity:80/258 - (31%) Gaps:88/258 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 GDKTKVRISISLKFYKQLQEHGA----DELLKREYGSLLTDTEEGYNVSVLINL---EEIPEDCE 107
            ||..:..:::.....:|..:.||    .|........||.|.:|.:.:.....|   :::.|..:
Zfish   121 GDSARAALNVITALLEQFGQGGACRETSEPFSYHNTFLLVDRQEAWVLETAGKLWAAQKVTEGVK 185

  Fly   108 QIAKRIGLLKRNCFASVFEKYFDYQEQGEEGQKRAVINYRNDETLYVEAKPDRVTVVFSTIFRDE 172
            .|:.::.:              |::...|....|:|...:.                   .:..|
Zfish   186 NISNQLTI--------------DFEISAEHPDLRSVAQAQG-------------------WWSGE 217

  Fly   173 DDVIIGKVFMQELREGRRASHTAPQVLFSHREPP--LELANTDARVGDNIGYVTFVLFPRHTNKE 235
            .|.                |.||   :||...||  :|:|....|.|.       .|..:|....
Zfish   218 GDF----------------SFTA---VFSPDHPPARMEMAKQRYRGGT-------ALLQQHNGSV 256

  Fly   236 TRDNTINLIHMFRDYLHYHIKCSKAYIHSRMRAKTSDFLKVLNR-----------ARPEPKNT 287
            |.:..::::   ||      |.|...:.|.....|...:.:|.|           |.|:|..:
Zfish   257 TAEVMMSIL---RD------KASGICMDSEGFRTTGSMVSILPRNPNMPCVHFLTATPDPSRS 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arpc2NP_001286102.1 P34-Arc 57..284 CDD:397935 41/246 (17%)
scrn2NP_001025287.1 Ntn_hydrolase 7..>232 CDD:294319 24/162 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4690
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.