powered by:
Protein Alignment Arpc2 and Scrn2
DIOPT Version :9
Sequence 1: | NP_001286102.1 |
Gene: | Arpc2 / 35311 |
FlyBaseID: | FBgn0032859 |
Length: | 301 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001012142.1 |
Gene: | Scrn2 / 360612 |
RGDID: | 1307741 |
Length: | 423 |
Species: | Rattus norvegicus |
Alignment Length: | 37 |
Identity: | 11/37 - (29%) |
Similarity: | 16/37 - (43%) |
Gaps: | 9/37 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 196 PQVLFSHREPPLELANTDARVGDNIGYVTFVLFPRHT 232
|.|:|: .|:| |..|.:..|.|:....||
Rat 25 PAVIFA--------KNSD-RPRDEVQEVVFIPAGTHT 52
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG4690 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.