DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arpc2 and Scrn2

DIOPT Version :10

Sequence 1:NP_610033.1 Gene:Arpc2 / 35311 FlyBaseID:FBgn0032859 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_001012142.1 Gene:Scrn2 / 360612 RGDID:1307741 Length:423 Species:Rattus norvegicus


Alignment Length:37 Identity:11/37 - (29%)
Similarity:16/37 - (43%) Gaps:9/37 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 PQVLFSHREPPLELANTDARVGDNIGYVTFVLFPRHT 232
            |.|:|:        .|:| |..|.:..|.|:....||
  Rat    25 PAVIFA--------KNSD-RPRDEVQEVVFIPAGTHT 52

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arpc2NP_610033.1 P34-Arc 57..284 CDD:461144 11/37 (30%)
Scrn2NP_001012142.1 PepD 21..>231 CDD:477862 11/37 (30%)

Return to query results.
Submit another query.