DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arpc2 and arpc2

DIOPT Version :9

Sequence 1:NP_001286102.1 Gene:Arpc2 / 35311 FlyBaseID:FBgn0032859 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_997864.1 Gene:arpc2 / 327068 ZFINID:ZDB-GENE-030131-5276 Length:299 Species:Danio rerio


Alignment Length:299 Identity:221/299 - (73%)
Similarity:264/299 - (88%) Gaps:0/299 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MILLEINNRIIEETLLVKYRNAQAGLKPESIDIRIADFDGVLYHISNVNGDKTKVRISISLKFYK 65
            |||||||||||||||.:|:.:|..|.|||::::..||||||||||||.|||||||.:||||||:|
Zfish     1 MILLEINNRIIEETLSLKFDSASNGNKPEAVEVTFADFDGVLYHISNPNGDKTKVMVSISLKFFK 65

  Fly    66 QLQEHGADELLKREYGSLLTDTEEGYNVSVLINLEEIPEDCEQIAKRIGLLKRNCFASVFEKYFD 130
            :||||||||||||.||:.|...|:|||:|:|.:|:.:|.:.|::..:.|:||||||||||||||.
Zfish    66 ELQEHGADELLKRVYGNFLVAPEDGYNISLLFDLDALPPNKEEMIHQAGILKRNCFASVFEKYFK 130

  Fly   131 YQEQGEEGQKRAVINYRNDETLYVEAKPDRVTVVFSTIFRDEDDVIIGKVFMQELREGRRASHTA 195
            :||:|.:|:||||::||:||::|:|||.|||||||||:|:|:||||||||||||.:|||||||||
Zfish   131 FQEEGRDGEKRAVVHYRDDESMYIEAKKDRVTVVFSTVFKDDDDVIIGKVFMQEFKEGRRASHTA 195

  Fly   196 PQVLFSHREPPLELANTDARVGDNIGYVTFVLFPRHTNKETRDNTINLIHMFRDYLHYHIKCSKA 260
            ||||||||||||||.:|||.|||||||:||||||||||..||||||||||.||||||||||||||
Zfish   196 PQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNANTRDNTINLIHTFRDYLHYHIKCSKA 260

  Fly   261 YIHSRMRAKTSDFLKVLNRARPEPKNTEKKTITGRTFKR 299
            |||:||||||||||||||||||:.:..|.|||:|:||.|
Zfish   261 YIHTRMRAKTSDFLKVLNRARPDAEKKEMKTISGKTFSR 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arpc2NP_001286102.1 P34-Arc 57..284 CDD:397935 173/226 (77%)
arpc2NP_997864.1 P34-Arc 57..284 CDD:281970 173/226 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574809
Domainoid 1 1.000 373 1.000 Domainoid score I846
eggNOG 1 0.900 - - E1_COG4690
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4187
Inparanoid 1 1.050 467 1.000 Inparanoid score I1501
OMA 1 1.010 - - QHG54321
OrthoDB 1 1.010 - - D1345377at2759
OrthoFinder 1 1.000 - - FOG0004402
OrthoInspector 1 1.000 - - oto39950
orthoMCL 1 0.900 - - OOG6_102851
Panther 1 1.100 - - LDO PTHR12058
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R88
SonicParanoid 1 1.000 - - X3120
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.