DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arpc2 and Arpc2

DIOPT Version :9

Sequence 1:NP_001286102.1 Gene:Arpc2 / 35311 FlyBaseID:FBgn0032859 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_001100389.1 Gene:Arpc2 / 301511 RGDID:1305848 Length:300 Species:Rattus norvegicus


Alignment Length:297 Identity:225/297 - (75%)
Similarity:260/297 - (87%) Gaps:0/297 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MILLEINNRIIEETLLVKYRNAQAGLKPESIDIRIADFDGVLYHISNVNGDKTKVRISISLKFYK 65
            |||||:|||||||||.:|:.||.||.|||::::..||||||||||||.|||||||.:||||||||
  Rat     1 MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNGDKTKVMVSISLKFYK 65

  Fly    66 QLQEHGADELLKREYGSLLTDTEEGYNVSVLINLEEIPEDCEQIAKRIGLLKRNCFASVFEKYFD 130
            :||.|||||||||.|||.|.:.|.|||||:|.:||.:|...:.|..:.|:||||||||||||||.
  Rat    66 ELQAHGADELLKRVYGSFLVNPESGYNVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQ 130

  Fly   131 YQEQGEEGQKRAVINYRNDETLYVEAKPDRVTVVFSTIFRDEDDVIIGKVFMQELREGRRASHTA 195
            :||:|:||:.||||:||:|||:|||:|.|||||||||:|:|:|||:||||||||.:|||||||||
  Rat   131 FQEEGKEGENRAVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTA 195

  Fly   196 PQVLFSHREPPLELANTDARVGDNIGYVTFVLFPRHTNKETRDNTINLIHMFRDYLHYHIKCSKA 260
            ||||||||||||||.:|||.|||||||:||||||||||...|||||||||.||||||||||||||
  Rat   196 PQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNATARDNTINLIHTFRDYLHYHIKCSKA 260

  Fly   261 YIHSRMRAKTSDFLKVLNRARPEPKNTEKKTITGRTF 297
            |||:||||||||||||||||||:.:..|.|||||:||
  Rat   261 YIHTRMRAKTSDFLKVLNRARPDAEKKEMKTITGKTF 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arpc2NP_001286102.1 P34-Arc 57..284 CDD:397935 176/226 (78%)
Arpc2NP_001100389.1 P34-Arc 57..284 CDD:397935 176/226 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335631
Domainoid 1 1.000 373 1.000 Domainoid score I860
eggNOG 1 0.900 - - E1_COG4690
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4187
Inparanoid 1 1.050 470 1.000 Inparanoid score I1461
OMA 1 1.010 - - QHG54321
OrthoDB 1 1.010 - - D1345377at2759
OrthoFinder 1 1.000 - - FOG0004402
OrthoInspector 1 1.000 - - oto96958
orthoMCL 1 0.900 - - OOG6_102851
Panther 1 1.100 - - LDO PTHR12058
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3120
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.