DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10949 and IMA2

DIOPT Version :9

Sequence 1:NP_001286101.1 Gene:CG10949 / 35310 FlyBaseID:FBgn0032858 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_014485.1 Gene:IMA2 / 854008 SGDID:S000005517 Length:589 Species:Saccharomyces cerevisiae


Alignment Length:172 Identity:40/172 - (23%)
Similarity:69/172 - (40%) Gaps:36/172 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 KDEEEEDSQDDLLNEQLIELV-KSH---PVLYDRHKIRV------SKNLAAKNEAWREISENLNV 179
            |:|..|:|::.....:.|.|: :.|   |:.:.|.:...      :|.....||::|   |.:|.
Yeast   420 KEEHGENSKEMKRFLEAIALISRDHARTPMQWSREEPNAGFSGPNAKPWFYLNESFR---EGINA 481

  Fly   180 SEE-----LCYNRWKK-LRDR--------FGREFRSHQINQST--PITWRYFNDLLFLGRHFRKG 228
            .:|     ...|.||: ||.|        :|.:|....::...  ..|.:|.|..||...:|...
Yeast   482 EDESKDPNSVLNFWKEALRFRKAHKDITVYGYDFEFIDLDNKKLFSFTKKYDNKTLFAALNFSSD 546

  Fly   229 -----VPLVLENIKRR-GRPPKAG-NPSGKTSKQPEGMVISS 263
                 :|....:.|.. |..|::. :.|.:|.|..||.:..|
Yeast   547 SIDFTIPNNSSSFKLEFGNYPRSEVDASSRTLKPWEGRIYIS 588

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10949NP_001286101.1 MADF 5..91 CDD:214738
MADF 140..226 CDD:214738 25/111 (23%)
IMA2NP_014485.1 AmyAc_SI_OligoGlu_DGase 16..503 CDD:200472 21/85 (25%)
Malt_amylase_C 514..585 CDD:406946 16/70 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.