DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10949 and IMA5

DIOPT Version :9

Sequence 1:NP_001286101.1 Gene:CG10949 / 35310 FlyBaseID:FBgn0032858 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_012319.1 Gene:IMA5 / 853214 SGDID:S000003752 Length:581 Species:Saccharomyces cerevisiae


Alignment Length:210 Identity:40/210 - (19%)
Similarity:70/210 - (33%) Gaps:63/210 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IERHPILYDKDCARSVKNAAQKDAAWKAISQKLGAS----------------------------E 46
            :|.|      |..|||.........|:.||.|:.|:                            :
Yeast   343 LENH------DQPRSVSRFGSDSPKWREISSKMLATLIISLTGTVFIYQGQELGMPNFKNRKIEQ 401

  Fly    47 RACIT---RWKSIRDRFGKE---FRRF--------QERPDEPTYWDM-FPRLLFLKDHYKQGLAR 96
            ..|:.   .:.:|:..:|::   .::|        ::....|..|.. .|...|.|| .|..:..
Yeast   402 IKCVEGTGTYAAIKRDYGEDSEKMKKFFEALALISRDHGRTPFPWSADEPSAGFSKD-AKPWIDM 465

  Fly    97 NESL-DGMRFEPRERKKRTKVDMEQERRRKDEEEED--------SQDDLLNEQLIELVKSHPVLY 152
            |||. ||:..|...:.|.:.....::..:..:|.:|        ...||.|::|....|.    .
Yeast   466 NESFRDGINAEAELKDKNSVFFFWKKALQVRKEHKDILVYGHNFQFIDLDNDKLFMFTKD----T 526

  Fly   153 DRHKIRVSKNLAAKN 167
            |..|:....|.::.|
Yeast   527 DNKKMFAVFNFSSDN 541

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10949NP_001286101.1 MADF 5..91 CDD:214738 21/123 (17%)
MADF 140..226 CDD:214738 6/28 (21%)
IMA5NP_012319.1 AmyAc_SI_OligoGlu_DGase 11..498 CDD:200472 29/161 (18%)
Malt_amylase_C 509..>548 CDD:413446 9/37 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.