DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10949 and MAL32

DIOPT Version :9

Sequence 1:NP_001286101.1 Gene:CG10949 / 35310 FlyBaseID:FBgn0032858 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_009858.3 Gene:MAL32 / 852602 SGDID:S000000503 Length:584 Species:Saccharomyces cerevisiae


Alignment Length:164 Identity:34/164 - (20%)
Similarity:51/164 - (31%) Gaps:65/164 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IERHPILYDKDCARSVKNAAQKDAAWKAISQKLGASERACIT----------------------- 51
            ||.|      |.|||:...|.....::.||.||.......:|                       
Yeast   345 IENH------DQARSITRFADDSPKYRKISGKLLTLLECSLTGTLYVYQGQEIGQINFKEWPIEK 403

  Fly    52 --------RWKSIRDRFG---KEFRRF--------QERPDEPTYW------------DMFPRLLF 85
                    .::.|:..||   ||.:.|        ::....|..|            |:.| ..|
Yeast   404 YEDVDVKNNYEIIKKSFGKNSKEMKDFFKGIALLSRDHSRTPMPWTKDKPNAGFTGPDVKP-WFF 467

  Fly    86 LKDHYKQGL-ARNESLDG---MRFEPRERKKRTK 115
            |.:.::||: ...||.|.   :.|..|..:.|.|
Yeast   468 LNESFEQGINVEQESRDDDSVLNFWKRALQARKK 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10949NP_001286101.1 MADF 5..91 CDD:214738 25/134 (19%)
MADF 140..226 CDD:214738
MAL32NP_009858.3 AmyAc_SI_OligoGlu_DGase 15..501 CDD:200472 33/162 (20%)
Malt_amylase_C 511..583 CDD:406946
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.