DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10949 and zgc:158423

DIOPT Version :9

Sequence 1:NP_001286101.1 Gene:CG10949 / 35310 FlyBaseID:FBgn0032858 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_001073552.1 Gene:zgc:158423 / 790938 ZFINID:ZDB-GENE-061215-58 Length:480 Species:Danio rerio


Alignment Length:244 Identity:47/244 - (19%)
Similarity:85/244 - (34%) Gaps:79/244 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 EEEEDSQDDLLNEQLIELVKSHPVLYDRHK--IRVSKNLAA---KNEAW----REISEN------ 176
            :.|..::::|  |.|:.|.         ||  |.:..||..   |..||    ..::|.      
Zfish   152 QSEVGTENEL--ESLLGLA---------HKKGIFIVLNLTPNFNKTSAWFNNFNAVAEKIKDACT 205

  Fly   177 -----------LNVSEELCYNRWKKLRDRFGREFRSHQINQSTPITWRYFNDLLFLGRHFRKGVP 230
                       |:...|:..:.|..:::.|.|...:.::.....:.....||:..|..  |.||.
Zfish   206 YWLDKGLDGIFLSDLNEIPTDAWPSIKEIFNRSDATKEVALMGSVNSMSVNDISVLLN--RSGVD 268

  Fly   231 LVLENIKRRGRPPKAGNPSGKTSKQPEGMVI----SSGEQI---W---------GADYPY----- 274
            |:|           .|.|....|.:.:..:|    ||.:|.   |         .|::|.     
Zfish   269 LLL-----------TGQPDLSDSGEKQAQIIKEFNSSIQQTSLGWRSRQDPGTLAAEFPIRLYQI 322

  Fly   275 ------STDNDDLEDDLELAYDEEIEILSEAEQATPYDFILSEATARQD 317
                  .|......::|.|..:|:::.|.:.|  .|.:...::|.|.|:
Zfish   323 LLFTLPGTPVFSAGEELGLKAEEQLQALWDLE--NPVEEKNAKAKALQE 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10949NP_001286101.1 MADF 5..91 CDD:214738
MADF 140..226 CDD:214738 19/111 (17%)
zgc:158423NP_001073552.1 SLC3A2_N 29..98 CDD:292647
AmyAc_family 81..391 CDD:298606 47/244 (19%)
AmyA 99..446 CDD:223443 47/244 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.