DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10949 and zgc:152938

DIOPT Version :9

Sequence 1:NP_001286101.1 Gene:CG10949 / 35310 FlyBaseID:FBgn0032858 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_001070756.1 Gene:zgc:152938 / 768145 ZFINID:ZDB-GENE-061013-458 Length:292 Species:Danio rerio


Alignment Length:234 Identity:48/234 - (20%)
Similarity:89/234 - (38%) Gaps:61/234 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 EQLIELVKSHPVLYDRHKIRVSKNLAAKNEAWREISENLNVSEELCYNRWKKLRDRFGREFRSHQ 203
            |.||.||.....|:|::.|.. |::..:...|:||:|.:....:....:||.|||.:.|:.|..|
Zfish    58 EGLISLVSDRRELFDQNHIDY-KHIDKREALWQEIAEKIGFHVDDVKTKWKNLRDTYIRKKREDQ 121

  Fly   204 -INQSTP---ITWRYFNDLLFL----------------------GRHFRKGVPLVLENIKRRGRP 242
             ..:.||   .||::...:.||                      |....|.:.:.:|:.. ...|
Zfish   122 CTGEQTPKKKKTWKFMKMMEFLATSSEQRRVHSSVKESADEVGDGSESEKSLSISVESAV-SSEP 185

  Fly   243 PKAGNPSGKTSKQPEGMVISSGEQIWGADYPYSTDNDD-----LEDDLELAYDEEIEILSEAEQA 302
            .:|.:...|.|..|:.:     |:...|......:.::     :|||:.|               
Zfish   186 VQANSKKRKRSVTPDFV-----EKYLAAKEVRDREREECRKQRMEDDISL--------------- 230

  Fly   303 TPYDFILSEATARQDLEPPQQLQVTTTTPATSEEIIHTI 341
                |::|.|...:.|.|.:|    ::......:::|.:
Zfish   231 ----FLMSLAPVIRRLPPSKQ----SSVKMRFHQVLHEV 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10949NP_001286101.1 MADF 5..91 CDD:214738
MADF 140..226 CDD:214738 27/111 (24%)
zgc:152938NP_001070756.1 MADF_DNA_bdg 60..128 CDD:287510 20/68 (29%)
BESS 226..260 CDD:281011 9/56 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1634040at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.