DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10949 and SLC3A1

DIOPT Version :9

Sequence 1:NP_001286101.1 Gene:CG10949 / 35310 FlyBaseID:FBgn0032858 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_000332.2 Gene:SLC3A1 / 6519 HGNCID:11025 Length:685 Species:Homo sapiens


Alignment Length:163 Identity:30/163 - (18%)
Similarity:50/163 - (30%) Gaps:67/163 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 AWREISENLNVSEELCYNRW----------KKLRDRFGREFRSHQIN---------QSTPITWRY 214
            :|.|     |:.|    .:|          .:|..|.|.::    :|         ..||||  |
Human   430 SWME-----NMPE----GKWPNWMIGGPDSSRLTSRLGNQY----VNVMNMLLFTLPGTPIT--Y 479

  Fly   215 FNDLLFLGRHFRKGVPLVLENIKR-------RGRPPKAGNPSGKTSKQPEGMVISSGEQIW-GAD 271
            :.:.:.:|.       :|..|:..       |.:.|...:.|....       .|.....| ..:
Human   480 YGEEIGMGN-------IVAANLNESYDINTLRSKSPMQWDNSSNAG-------FSEASNTWLPTN 530

  Fly   272 YPYSTDNDDLE-----------DDLELAYDEEI 293
            ..|.|.|.|::           .||.|.:..|:
Human   531 SDYHTVNVDVQKTQPRSALKLYQDLSLLHANEL 563

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10949NP_001286101.1 MADF 5..91 CDD:214738
MADF 140..226 CDD:214738 15/75 (20%)
SLC3A1NP_000332.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..56
AmyAc_SLC3A1 116..569 CDD:200494 30/163 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.