Sequence 1: | NP_001286101.1 | Gene: | CG10949 / 35310 | FlyBaseID: | FBgn0032858 | Length: | 459 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_683419.5 | Gene: | si:ch211-207i20.3 / 555734 | ZFINID: | ZDB-GENE-141222-71 | Length: | 263 | Species: | Danio rerio |
Alignment Length: | 205 | Identity: | 39/205 - (19%) |
---|---|---|---|
Similarity: | 84/205 - (40%) | Gaps: | 53/205 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MDDDELIKLIERHPILYDKDCARSVKNAAQKDAAWKAISQKLGASERACITRWKSIRDRFGKEFR 65
Fly 66 RFQE------RPDEPTYWDMFPRLLFL--KDHYKQGLARNE------------------------ 98
Fly 99 SLDGMRFEPRERKKRTKVDM--------EQERRRKDEEEEDSQDDLL------------NEQLIE 143
Fly 144 LVKSHPVLYD 153 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10949 | NP_001286101.1 | MADF | 5..91 | CDD:214738 | 22/93 (24%) |
MADF | 140..226 | CDD:214738 | 3/14 (21%) | ||
si:ch211-207i20.3 | XP_683419.5 | MADF | 35..122 | CDD:214738 | 22/87 (25%) |
BESS | 199..233 | CDD:308542 | 5/33 (15%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1634040at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |