DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10949 and Adf1

DIOPT Version :9

Sequence 1:NP_001286101.1 Gene:CG10949 / 35310 FlyBaseID:FBgn0032858 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_001260730.1 Gene:Adf1 / 47082 FlyBaseID:FBgn0284249 Length:274 Species:Drosophila melanogaster


Alignment Length:338 Identity:81/338 - (23%)
Similarity:135/338 - (39%) Gaps:79/338 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 DSQDDLLNEQ----LIELVKSHPVLYDRHKIRVSKNLAAKNEAWREISENLNVSEELCYNRWKKL 191
            |..|..|.:|    |||.||.:||:|||..... |:...|.:.|::|:|.|.|.|:.|..|||.|
  Fly     2 DKLDANLEQQFDLNLIEAVKLNPVIYDRSHYNY-KHFVRKAQTWKQIAETLGVPEQKCTKRWKSL 65

  Fly   192 RDRFGREFRSHQINQSTPITWRYFNDLLFLG---RHFRKGVPLVLENIKRRGRPPKAGNPSGKTS 253
            ||:|.||.:..|.::     ||||..:.||.   |.:|:.:.....|..:...  :..:||.:..
  Fly    66 RDKFAREMKLCQESR-----WRYFKQMQFLVDSIRQYRESLLGKCANGSQSAN--QVADPSQQQQ 123

  Fly   254 KQPEGMVISSGEQIWGADYPYSTDNDDLEDDLELAYDEEIEILSEAEQAT-------PYDFILSE 311
            .|.:.:|....:...|:    :|.:..     .|.:..||.:.|:|:.||       ||.:    
  Fly   124 AQQQTVVDIFAQPFNGS----ATTSAQ-----ALTHPHEITVTSDAQLATAVGKDQKPYFY---- 175

  Fly   312 ATARQDLEPPQQLQVTTTTPATSEEIIHTIARVNPVVEESSSLPGDSVPSAAISDKLLTTVIANM 376
                   |||  |:...:....|:.:::||......|.::.|          ..|:....|:.:|
  Fly   176 -------EPP--LKRERSEEEHSDNMLNTIKIFQNNVSQAVS----------AEDQSFGMVVTDM 221

  Fly   377 ETVLQQSRELQAQIHHEQEQEREQRSTQPANSLLAKAQMLLDGLSPSERASAERKIVQFLCQCQI 441
            ...|...::.:|::|              ....|...|:|...... ......|:::|.|     
  Fly   222 LNTLGVRQKAEAKVH--------------IIKYLTDMQLLAQHNKYXLSGGCHRQLLQLL----- 267

  Fly   442 KALDGEEIEDVAP 454
                  ::|.|.|
  Fly   268 ------QLESVLP 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10949NP_001286101.1 MADF 5..91 CDD:214738
MADF 140..226 CDD:214738 37/92 (40%)
Adf1NP_001260730.1 MADF 15..95 CDD:214738 35/85 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438475
Domainoid 1 1.000 62 1.000 Domainoid score I10337
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1634040at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm49873
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.