DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10949 and CG12768

DIOPT Version :9

Sequence 1:NP_001286101.1 Gene:CG10949 / 35310 FlyBaseID:FBgn0032858 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_001262229.1 Gene:CG12768 / 40513 FlyBaseID:FBgn0037206 Length:429 Species:Drosophila melanogaster


Alignment Length:346 Identity:76/346 - (21%)
Similarity:126/346 - (36%) Gaps:86/346 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 SQDDLLNEQLIELVKSHPVLYD---RHKIRVSKNLAAKNEAWREISENLNVSEELCYNRWKKLRD 193
            |:.::...:|||||:.:|:|:|   .|..|..|..|.|   |.|:....||:.|.....:..||:
  Fly     4 SRHNIEKRRLIELVRLNPILWDCRLPHYKRSDKRKAIK---WNELGRLFNVNGERVQRTFTSLRE 65

  Fly   194 RFGREFRSHQINQSTPI--TWRYFNDLLFLGRHFRK-------------GVPLVLENIKRRGR-- 241
            .|.||....::..:|..  .|.|::.:.||....|:             ..|:...:......  
  Fly    66 IFRRELNHEKMLGTTRFKSKWEYYDAMAFLKEVIRERKSRERIKHGSLDSAPVATGSSNNNNNCV 130

  Fly   242 ---------------------PPKAGNPSGKTSKQPEGMVISSGEQIWGADYPYSTDNDDLE-DD 284
                                 |....||:.:...|||..          :..|.:..:..|. ..
  Fly   131 SRNSSNNNSSSAALDEYQYFAPSDPNNPNNQPQLQPEPK----------SSLPVTIPSLSLTLSQ 185

  Fly   285 LELAYDEEIEILSEAEQATPYDFILSEATARQDLEPPQQLQVTTTTPATSEEIIHTIARVNPVVE 349
            |.:|..::.:.| :|.|..| |..|   |:.|....|..|  |..|||       .:|:.:|...
  Fly   186 LPVALQQQAQHL-QALQLQP-DVTL---TSLQKQSLPTSL--TNATPA-------PLAQTSPAQV 236

  Fly   350 ESSSLPGDSVPSAAISDKLLTTVIANMETVL-----QQSRELQAQIHHEQEQEREQR-------- 401
            .|||....|.||..|.|:..:......|.|:     :.:|:..|.|..:.:|:.:.|        
  Fly   237 LSSSRSCSSSPSIYIKDEPCSPAGGCPEEVMTGNGPEATRKKLATIRPQTKQQLKARLQLPTPKN 301

  Fly   402 ----STQPANSLLAKAQMLLD 418
                :|.|.:.::.....|:|
  Fly   302 SSSYATSPPHLIINANNELID 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10949NP_001286101.1 MADF 5..91 CDD:214738
MADF 140..226 CDD:214738 28/90 (31%)
CG12768NP_001262229.1 MADF 12..100 CDD:214738 28/90 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438461
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.