DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10949 and CG3919

DIOPT Version :9

Sequence 1:NP_001286101.1 Gene:CG10949 / 35310 FlyBaseID:FBgn0032858 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_001261840.1 Gene:CG3919 / 39582 FlyBaseID:FBgn0036423 Length:318 Species:Drosophila melanogaster


Alignment Length:292 Identity:74/292 - (25%)
Similarity:119/292 - (40%) Gaps:56/292 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 LNEQLIELVKSHPVLYDRHKIRVSKNLAAKNEAWREISENLNVSEELCYNRWKKLRDRFGREFRS 201
            :|.::..|||.||.|||||.....:....|| ||:|||..:..|.:.|..||:.:|..:.|..:.
  Fly    17 INAKICHLVKLHPCLYDRHDDNYLRKSTVKN-AWKEISNEMRNSVKSCKERWRNIRSSYARSIKL 80

  Fly   202 HQ-INQSTPITWRYFNDLLFLGRHFRKGVPLVLENIKRRGRPPKAGNPSGKTSKQPEGMVISSGE 265
            |. .|     |:...::|.||.:|...|||:.|     |||..:...........||..|.:..|
  Fly    81 HHGAN-----TYYLNSELKFLQKHITPGVPVPL-----RGRRSRPKGQEEHDEGDPETPVEAILE 135

  Fly   266 QIWG--------ADYPYSTDNDDLEDDLELAYDEEIEILSEAEQATPYDFILSEATARQDLEPPQ 322
            .:..        |...:|||.....|                .:||.::   :|.::..|.|...
  Fly   136 MVHSPSFLNSEHAQSRHSTDPASATD----------------VEATQFN---NEPSSIMDFEDTV 181

  Fly   323 QLQVTTTTPATSEEI---IHTIARVNPVVE--ESSSLPGDSVPSAAISDKLLTTV-----IANME 377
            ..::.|.:.::.:|.   ..|:.|| |::|  ::|:...:::|.....|..|..:     ..|..
  Fly   182 PAEMRTESDSSEKEAKVGEITLYRV-PLLEFPKTSTRCIEALPIMDFDDAFLQGLRPEIKHMNFH 245

  Fly   378 TVLQQSR---ELQAQIHHEQEQEREQRSTQPA 406
            ..|...|   :|..:|.|   .|:...||.||
  Fly   246 QKLYFKRRVYDLLGEIFH---SEQSASSTHPA 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10949NP_001286101.1 MADF 5..91 CDD:214738
MADF 140..226 CDD:214738 30/86 (35%)
CG3919NP_001261840.1 MADF 20..100 CDD:214738 29/85 (34%)
BESS 226..260 CDD:281011 6/33 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438466
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.