DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10949 and amy2al1

DIOPT Version :9

Sequence 1:NP_001286101.1 Gene:CG10949 / 35310 FlyBaseID:FBgn0032858 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_956722.1 Gene:amy2al1 / 393400 ZFINID:ZDB-GENE-040426-1606 Length:512 Species:Danio rerio


Alignment Length:130 Identity:29/130 - (22%)
Similarity:48/130 - (36%) Gaps:31/130 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 LVKSHP---------VLYDRHKIRVSKNLAAKNEAWREISENLNVSEE--------------LCY 185
            |:.:||         ..:|||.:    |...:|: |.....|.:.|.:              :|.
Zfish   342 LMLAHPYGVTAVMSSYRWDRHFV----NGKDQND-WMGPPSNADGSTKSVPINPDSTCGDNWICE 401

  Fly   186 NRWKKLRDRFGREFRSHQINQSTPITWRYFNDLLFLGRHFRKGVPLVLENIKRRGRPPKAGNPSG 250
            :||:::|:..  .||:....|.....|...|:.:...|. .||..::..|........|.|.|||
Zfish   402 HRWRQIRNMV--NFRNVVNGQPLSNWWDNNNNQIAFSRG-SKGFIVINNNDWDLNVMLKTGLPSG 463

  Fly   251  250
            Zfish   464  463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10949NP_001286101.1 MADF 5..91 CDD:214738
MADF 140..226 CDD:214738 21/104 (20%)
amy2al1NP_956722.1 AmyAc_bac_euk_AmyA 25..417 CDD:200456 17/81 (21%)
AmyA 46..>315 CDD:223443
Aamy_C 424..511 CDD:214749 11/41 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.