DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10949 and CG6163

DIOPT Version :9

Sequence 1:NP_001286101.1 Gene:CG10949 / 35310 FlyBaseID:FBgn0032858 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_001261709.1 Gene:CG6163 / 39274 FlyBaseID:FBgn0036155 Length:428 Species:Drosophila melanogaster


Alignment Length:158 Identity:36/158 - (22%)
Similarity:64/158 - (40%) Gaps:39/158 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LIKLIERHPILYDKDCARSVKNAAQK--DAAWKAISQKLGASERACITRWKSIRDRFGKEFRRFQ 68
            :|..|:..|.|: ....||.|...|.  .|.||..:.::|.:.....|||..|:.|:..|.::  
  Fly   227 IIDAIKTRPSLW-AGRQRSEKGQGQSRTSAVWKEAAMEMGLTPTLMQTRWSIIKQRYVDELQK-- 288

  Fly    69 ERPDEPTY------WDMFPRLLFLKDHYKQGLARNESLDGMRFEPRERKKRTKVDMEQERRRKDE 127
            ||..:.::      |:.|.|:.|:::...:                      ||| |:|:.|   
  Fly   289 ERHAQYSHQSFRSTWEHFDRMSFMREILLK----------------------KVD-EREQTR--- 327

  Fly   128 EEEDSQDDLLNEQLIELVKSHPVLYDRH 155
              |..|:.:..:|..:..:.||..:..|
  Fly   328 --EQIQEIVSEQQHHQQTQHHPSQHLHH 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10949NP_001286101.1 MADF 5..91 CDD:214738 24/92 (26%)
MADF 140..226 CDD:214738 4/16 (25%)
CG6163NP_001261709.1 MADF 12..98 CDD:214738
MADF 226..316 CDD:214738 24/91 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438478
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.