DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10949 and CG6683

DIOPT Version :9

Sequence 1:NP_001286101.1 Gene:CG10949 / 35310 FlyBaseID:FBgn0032858 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_648232.1 Gene:CG6683 / 38970 FlyBaseID:FBgn0035902 Length:197 Species:Drosophila melanogaster


Alignment Length:316 Identity:69/316 - (21%)
Similarity:109/316 - (34%) Gaps:130/316 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 QLIELVKSHPVLYDRHKIRVSKNLAAKN---EAWREISENLNVSEELCYNRWKKLRDRFGREFRS 201
            :|||||:::|.||:| ::|.:...|.|.   |.|..|:.:||.....|.:||..|..:..||...
  Fly     7 RLIELVRANPKLYER-ELRNAPYEAHKKRHPEIWSSIATSLNSEASACVSRWNHLVAKQRRELAK 70

  Fly   202 HQINQSTPITWRYFNDLLFLGRHFRKGVPLVLENIKRRGRPPKAGNPSGKTSKQPEGMVISSGEQ 266
            .:.. .|...|.....|.||..|..   |:...|             ||..|:.    .:.|.::
  Fly    71 EKAG-GTGSDWSLLPHLKFLQHHHH---PINHRN-------------SGDLSRS----TLKSSDE 114

  Fly   267 IWGADYPYSTDNDDLEDDLELAYDEEIEILSEAEQATPYDFILSEATARQDLEPPQQLQVTTTTP 331
            :          ||| ||.|:.|.||::.:...|.                  .||          
  Fly   115 V----------NDD-EDPLQEAMDEQLAVAGAAP------------------APP---------- 140

  Fly   332 ATSEEIIHTIARVNPVVEESSSLPGDSVPSAAISDKLLTTVIANMETVLQQSRELQAQIHHEQEQ 396
                        .||                           |:...|.|..:.::|        
  Fly   141 ------------TNP---------------------------AHATPVAQAEKRIEA-------- 158

  Fly   397 EREQRSTQPANSLLAKAQMLLDGLSPSERASAERKIVQFLCQCQIKALDGEEIEDV 452
                               ||:||..:.|..||::|:.:||:|.::||:.|:|:|:
  Fly   159 -------------------LLEGLGEANRIKAEKRILAYLCKCNLRALNDEQIDDI 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10949NP_001286101.1 MADF 5..91 CDD:214738
MADF 140..226 CDD:214738 29/88 (33%)
CG6683NP_648232.1 MADF 7..94 CDD:214738 29/88 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009996
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.