DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10949 and Amyrel

DIOPT Version :9

Sequence 1:NP_001286101.1 Gene:CG10949 / 35310 FlyBaseID:FBgn0032858 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_477262.1 Gene:Amyrel / 36863 FlyBaseID:FBgn0020506 Length:493 Species:Drosophila melanogaster


Alignment Length:228 Identity:47/228 - (20%)
Similarity:75/228 - (32%) Gaps:66/228 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 DSQDDLLNEQLIELVKSHPVLYDRHKIRVSKNLAAKNEAWREIS------ENLNVSEELCYNR-- 187
            |...|.:..:|||.: .|.:.......||.   |||:.|..::.      .|||:.....:|.  
  Fly   179 DQSSDWVRSKLIEFL-DHLIELGVAGFRVD---AAKHMASEDLEYIYSSLSNLNIDHGFPHNSRP 239

  Fly   188 --WKKLRDRFGRE--FRSHQINQSTPITWRYFNDLLFLGRHFRKGVPLVLENIKRRGRPPKAGNP 248
              ::::.|. |.|  .|....:......:|:..:   :|..||                   ||.
  Fly   240 FIFQEVIDH-GHETVSRDEYKDLGAVTEFRFSEE---IGNAFR-------------------GNN 281

  Fly   249 SGKTSKQPEGMVISSGEQIWGADYPY--------STDNDDLEDD----LELAYDEEIEILSEAEQ 301
            :.|..            |.||.|:.:        ..||.|.:.|    |......:.::.:....
  Fly   282 ALKWL------------QSWGTDWGFLPSGQALTFVDNHDNQRDAGAVLNYKSPRQYKMATAFHL 334

  Fly   302 ATPYDF---ILSEATARQDLEPPQQLQVTTTTP 331
            |.||..   :.|.|....|..|||..|....:|
  Fly   335 AYPYGISRVMSSFAFDDHDTPPPQDAQERIISP 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10949NP_001286101.1 MADF 5..91 CDD:214738
MADF 140..226 CDD:214738 20/97 (21%)
AmyrelNP_477262.1 AmyAc_bac_euk_AmyA 29..398 CDD:200456 47/228 (21%)
Aamy_C 404..492 CDD:214749
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.