DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10949 and CG13204

DIOPT Version :9

Sequence 1:NP_001286101.1 Gene:CG10949 / 35310 FlyBaseID:FBgn0032858 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_610678.1 Gene:CG13204 / 36227 FlyBaseID:FBgn0033627 Length:605 Species:Drosophila melanogaster


Alignment Length:325 Identity:69/325 - (21%)
Similarity:116/325 - (35%) Gaps:86/325 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 RKDEEEEDSQDDLLNEQLIELVKSHPVLYDRHKIRVSKNLAAKNEAWREISENLNVSEELCYNRW 188
            |...|...:.|:  ....||:||.:.|:|:.|.... ||:..|.:.|.:|::.:.:|.|....:|
  Fly     8 RAISESSTTSDN--TSDFIEIVKKYDVVYNNHNPDY-KNVEVKLKVWTQIADEIGLSVEASKRKW 69

  Fly   189 KKLRDRFGREFRSHQINQSTPITWRYF---NDLLFLGRHFRKGVPLVLENIKRRGRPPKAGNPSG 250
            |.|||.:.:..||.::...|...::|:   :.:.|| :.|             :|....:.|.:|
  Fly    70 KNLRDSYTKYLRSFRVGTKTSKKYQYWAHADHMDFL-KPF-------------QGPGRNSANGNG 120

  Fly   251 KTSKQPEGMVISSGEQIWGADYPYSTDNDDLEDDLELAYDEEIEILSEAEQATPYDFILSEATAR 315
            |                       |.|.||.|.|  ..|    ::|::|              |.
  Fly   121 K-----------------------SNDEDDTECD--FGY----QVLAKA--------------AS 142

  Fly   316 QDLEPPQQLQVTTTTPATSEEIIHTIARVNPVVEESS-----SLPGDSVPSAAISDKLLTTVIAN 375
            ...|...::.:.|.:...|....||:......:..:|     |..|.:.|...||..      :|
  Fly   143 NGGEDELKITIATASAGCSSMGTHTVNTYTTALSSTSASGITSSLGATTPPNMISPG------SN 201

  Fly   376 METVLQQSRELQAQIHHEQEQEREQRS------------TQPANSLLAKAQMLLDGLSPSERASA 428
            :......|..:..|||:.........|            |.||.|....|.:|...:||:...:|
  Fly   202 LGGTGGGSGSVGPQIHNSNSNGSATGSLNCAAVAPLSSMTPPATSGSNSAVVLPLPISPASSVAA 266

  Fly   429  428
              Fly   267  266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10949NP_001286101.1 MADF 5..91 CDD:214738
MADF 140..226 CDD:214738 25/88 (28%)
CG13204NP_610678.1 MADF 22..108 CDD:214738 25/87 (29%)
BESS 478..510 CDD:281011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.