DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10949 and CG7745

DIOPT Version :9

Sequence 1:NP_001286101.1 Gene:CG10949 / 35310 FlyBaseID:FBgn0032858 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_610671.1 Gene:CG7745 / 36210 FlyBaseID:FBgn0033616 Length:506 Species:Drosophila melanogaster


Alignment Length:308 Identity:76/308 - (24%)
Similarity:121/308 - (39%) Gaps:71/308 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 LLNEQLIELVKSHPVLYDRHKIRVS-----KNLAAKNEAWREISENLNVSEELCYNRWKKLRDRF 195
            :::||||:.|..|.|:|:|.|..::     .....|:|||:.|:..|....:.|..|||.||:|:
  Fly     1 MMDEQLIDEVAQHGVIYNRQKYYLNGGANGGKYETKDEAWQLIAMKLRTDVDTCKKRWKYLRERY 65

  Fly   196 GREFRSHQINQSTPITWR-----YFNDLLFLGRHFR-----KGVPLVLENIKRRGRPPKAGNPSG 250
                 ..|..|..|..:.     |...:.||.:|.:     :.||..|.:       |::.|.||
  Fly    66 -----VSQRKQGDPPVYEHLSRPYLEKMKFLDQHIQPRKSYRHVPNFLTS-------PQSANSSG 118

  Fly   251 KTSKQPE---------GMVISSGEQIWGADYPYSTDNDDLEDDLELAYDEEIE-----ILSEAEQ 301
            ....|.:         ....|||:    :...:..|.......|.......:|     :..||:|
  Fly   119 YNEYQVDKSNGSMKNVSQFGSSGQ----SHLYHQPDQQHAMSALSNVAASALENVNGQVKIEADQ 179

  Fly   302 ATPYDFILSEATARQDLEPPQQLQVTTTTPATSEEIIHTIARVNPVVEESSSLPGDSVPSAAI-- 364
            .. .||  :.|.|.|.|:...|.|:.           ...|.|..|:.:||....|.....::  
  Fly   180 VF-RDF--AAAVASQQLQHISQSQMQ-----------QQAAAVAAVMADSSQGYQDQYKDGSVGM 230

  Fly   365 -----SDKLLTTVIANMETVLQQSRELQ---AQIHHEQEQEREQRSTQ 404
                 |...||:..::|::.|  |..||   |..||.|:|.::|:..|
  Fly   231 NGAQNSAGSLTSTSSSMKSPL--SSPLQGIGAGSHHPQQQTQQQQQQQ 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10949NP_001286101.1 MADF 5..91 CDD:214738
MADF 140..226 CDD:214738 29/95 (31%)
CG7745NP_610671.1 MADF 5..96 CDD:214738 29/95 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438476
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.