DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10949 and Mal-A8

DIOPT Version :9

Sequence 1:NP_001286101.1 Gene:CG10949 / 35310 FlyBaseID:FBgn0032858 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_610384.1 Gene:Mal-A8 / 35830 FlyBaseID:FBgn0033297 Length:588 Species:Drosophila melanogaster


Alignment Length:247 Identity:42/247 - (17%)
Similarity:80/247 - (32%) Gaps:85/247 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 DEPTYWDMFPRLLFLKDHYKQGLARNESLD---GMRFEPRERKKRTKVDMEQERRRKDEEEEDSQ 133
            |...::|:.|....|:| ::..:.|.:.||   .:.|.|......::..::..:|.|..|:    
  Fly    92 DISDFFDIQPEYGTLED-FRTLIKRAKELDLKIVLDFVPNHSSNESEWFLKSVKREKGYED---- 151

  Fly   134 DDLLNEQLIELVKSHPVLYDRHKIRVSKNLAA-----------KNEAWREISENLNVSEELCYNR 187
                             .|..|..:|:.....           :..||                .
  Fly   152 -----------------YYVWHDGKVNSTTGKREPPTNWLQYFRGSAW----------------E 183

  Fly   188 WKKLRDRFGREFRSHQINQSTPITWRYFNDLLFLGRHFRKGVPLVLENIKRRGR----------- 241
            |.::|    :::..||.....|       ||     ::|.  |||:|.:||..|           
  Fly   184 WNEVR----QQYYLHQFAVQQP-------DL-----NYRN--PLVVEQMKRVLRYWLNEGVSGFR 230

  Fly   242 ----PPKAGNPSGKTSKQPEGMVISSGEQIWGADYPYSTDNDDLEDDLELAY 289
                ||..........:.|:.:|..:.|.....||..:|..::..:.:::.|
  Fly   231 CDALPPLFEVVPDSDGQFPDEVVSGATEDKEDRDYLTTTYIENQPETIDMVY 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10949NP_001286101.1 MADF 5..91 CDD:214738 5/18 (28%)
MADF 140..226 CDD:214738 12/96 (13%)
Mal-A8NP_610384.1 AmyAc_maltase 30..506 CDD:200467 42/247 (17%)
trehalose_treC 33..585 CDD:274115 42/247 (17%)
Malt_amylase_C 487..585 CDD:295440
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.