DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10949 and Mal-A1

DIOPT Version :9

Sequence 1:NP_001286101.1 Gene:CG10949 / 35310 FlyBaseID:FBgn0032858 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_476627.3 Gene:Mal-A1 / 35824 FlyBaseID:FBgn0002570 Length:577 Species:Drosophila melanogaster


Alignment Length:403 Identity:84/403 - (20%)
Similarity:137/403 - (33%) Gaps:137/403 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 FGKEFRRFQERPDEPTYWDMF----PRLLFLKDH------YKQGLARNESLDGMRFEPRERKKRT 114
            |..:..|:.:.||||...|..    |     .||      |.|.:.  |::| |.::.||.....
  Fly   227 FEVDLDRYNQYPDEPLTNDSVNCPDP-----DDHCYTQHIYTQDMP--ETID-MVYQWRELVDEF 283

  Fly   115 KVDMEQERRRKDEEEEDSQDDLL--------NEQLIELVKSH-PVLYDRHKIRVSKNLAAK-NEA 169
            .|:...::|....|...|.::::        |       .|| |..:|   ...|.|.|:| .|.
  Fly   284 HVENGGDKRLLMTEAYTSFENIMTYYGNGVRN-------GSHIPFNFD---FLTSINNASKAGEY 338

  Fly   170 WREISENLNVSEELCYNRW-------KKLRDRFGREFRSHQIN---QSTP--------------- 209
            ...|.:.::...|..|..|       |::..|||.: |:..||   |:.|               
  Fly   339 VEHIKKWMDAMPEGVYANWVLGNHDNKRVASRFGVQ-RTDLINILLQTLPGHAVTYNGEELGMTD 402

  Fly   210 --ITWRYFNDLLFLGRHFRKGVPLVL----ENIKRRGRPPKAGNPSGKTSKQPEGMVISSGEQIW 268
              |:|....|            |...    :|...|.|.| |.:|....:....|  .:|.:..|
  Fly   403 VWISWEDTVD------------PNACNSDPDNYYARSRDP-ARSPYQWDASSKAG--FTSADHTW 452

  Fly   269 --GADYPYSTDN-------------------------DDLEDDLEL-AYDEEIEILSEAEQATP- 304
              .|| .|.|:|                         ...:.:|.: |.|:::.|.|..:..:. 
  Fly   453 LPVAD-DYKTNNALQQLRAPRSHLQIFKKLVRVRKEPSFRQGELNIQAIDDDVIIYSRQKTGSDL 516

  Fly   305 YDFILSEATARQDLEPPQQLQVTTTTPATSEEIIHTIARVNPVVEESSSLPGDSVPSAAISDKLL 369
            |..:|:..:..:.|:..:..::     .|..|:|.|..       .|..:.||.:.|        
  Fly   517 YVIVLNLGSTSKTLDLTKYYEL-----GTQAEVITTSL-------SSQYIDGDVIKS-------- 561

  Fly   370 TTVIAN--METVL 380
            |..:||  :.|||
  Fly   562 TEFVANPYVGTVL 574

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10949NP_001286101.1 MADF 5..91 CDD:214738 10/40 (25%)
MADF 140..226 CDD:214738 25/114 (22%)
Mal-A1NP_476627.3 AmyAc_maltase 21..496 CDD:200467 62/303 (20%)
Alpha-amylase 45..404 CDD:278554 44/195 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.