DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10949 and Coop

DIOPT Version :9

Sequence 1:NP_001286101.1 Gene:CG10949 / 35310 FlyBaseID:FBgn0032858 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_001260776.1 Gene:Coop / 35677 FlyBaseID:FBgn0263240 Length:358 Species:Drosophila melanogaster


Alignment Length:282 Identity:60/282 - (21%)
Similarity:111/282 - (39%) Gaps:62/282 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 EQLIELVKSHPVLYDRHKIRVSKNLAAKNEAWREISENLNVSEELCYNRWKKLRDRFGREFRSHQ 203
            ::||..|...|:|:.|:.....|. :.....|.|:.:::|:..::|..:|..|||.|.:.:..:.
  Fly    41 KRLIAAVSRRPMLWLRNNANGQKR-SDITPVWFEVGQDVNLPADICRIKWGHLRDNFRKVYIRNN 104

  Fly   204 INQSTPITWRYFNDLLFLGRHFRKGVPLVLENIKRRGRPPKAGNPSGKTSK--------QPEGMV 260
            ::..||.:||::||:.|:       .|.|.|||.|:.|.....:|.|..::        :.:.|.
  Fly   105 LSNETPSSWRFYNDMRFM-------EPAVHENIMRQTRSSSKKHPPGHWTENNNVLGPDKYDSMP 162

  Fly   261 ISSGEQIWGADYPYSTD---------------------------------NDDLEDDLELAYDEE 292
            |.:.|.|....:.|.::                                 .:|.|||.:...|..
  Fly   163 IVATEPICELSHSYDSELHQPSFSDISSFFEDRDCQPPENKRFKSEPSQREEDEEDDDDFDEDAA 227

  Fly   293 IEILSE-----AEQATPYDFILSEATARQDLEPPQQLQVTTTTPATSEEIIHTIARVNPVVEESS 352
            .|.|.|     |:.|:...|.:.......::|     |..|.|.|.:..  |..:.:.. .:|:.
  Fly   228 SENLEEERGNRADAASSGVFTIEVLDDDDEME-----QAVTKTKANNTS--HGGSSLKS-EQEAK 284

  Fly   353 SLPGDSVPSAAISDKLLTTVIA 374
            .......|:|.:..|.::|.:|
  Fly   285 VFSNSQSPTADLPFKYISTDVA 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10949NP_001286101.1 MADF 5..91 CDD:214738
MADF 140..226 CDD:214738 23/85 (27%)
CoopNP_001260776.1 MADF 42..124 CDD:214738 23/89 (26%)
BESS 320..353 CDD:281011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D98646at50557
OrthoFinder 1 1.000 - - FOG0009996
OrthoInspector 1 1.000 - - otm49873
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.