DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10949 and Mal-B2

DIOPT Version :9

Sequence 1:NP_001286101.1 Gene:CG10949 / 35310 FlyBaseID:FBgn0032858 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_001188791.2 Gene:Mal-B2 / 34598 FlyBaseID:FBgn0032382 Length:583 Species:Drosophila melanogaster


Alignment Length:267 Identity:50/267 - (18%)
Similarity:95/267 - (35%) Gaps:85/267 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 EEEEDSQDDLLNEQLIELVKSHPVLYDRHKIRVSKNLAAKNEAWRE--------ISENLNVSEEL 183
            ||..|:..:|..:.:::.|.:|.  .|:|:  ..|..||:...:.:        :.||   ...:
  Fly   111 EELIDTAFELGIKVVLDFVPNHS--SDQHE--WFKKSAAREPGYEDFYVWHDGIVQEN---GTRV 168

  Fly   184 CYNRWKKLRDRF---------GRE-FRSHQ-------INQSTPITWRYFNDLLFLGRHFRKGVP- 230
            ..|.|..:   |         ||| :..||       :|...|...:..:|:|..  ...|||. 
  Fly   169 PPNNWPSV---FYGSAWEWHEGREQYYLHQFTKEQPDLNYRNPKVVQAMDDVLLF--WLNKGVAG 228

  Fly   231 -------LVLENIKRRGRPPKAGNPSGKTSKQPEGMVISSGEQIWGADYPYSTDNDDLEDDLELA 288
                   .:.|:...:..|     .||||:   :.:.....:.|:..|.|               
  Fly   229 FRIDAVNHLFEDESLKDEP-----LSGKTT---DSLSYDYTKHIYSRDLP--------------- 270

  Fly   289 YDEEIEILSEAEQATPYDFILSEATARQDLEPPQQLQVTTTTPATSEEIIHTIARVNPVVEESSS 353
              |.:|::....|      :|.:.:|:.. |.|.::.:|        |....:.::....|:|:.
  Fly   271 --EVLEMIHHWRQ------LLDDFSAKHP-ERPTRIMMT--------EAYAGLTQLADYYEDSNG 318

  Fly   354 LPGDSVP 360
            :.|..:|
  Fly   319 VRGSHLP 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10949NP_001286101.1 MADF 5..91 CDD:214738
MADF 140..226 CDD:214738 21/110 (19%)
Mal-B2NP_001188791.2 AmyAc_maltase 33..502 CDD:200467 50/267 (19%)
Malt_amylase_C 510..>541 CDD:351862
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.