DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10949 and Slc3a1

DIOPT Version :9

Sequence 1:NP_001286101.1 Gene:CG10949 / 35310 FlyBaseID:FBgn0032858 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_058912.1 Gene:Slc3a1 / 29484 RGDID:3709 Length:683 Species:Rattus norvegicus


Alignment Length:240 Identity:47/240 - (19%)
Similarity:80/240 - (33%) Gaps:87/240 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 KGVPLVLENIKRRGRPPKAGNPSGKTSKQP--EGMVISSGE----QIW-------GADYP----- 273
            ||:.|:::.|           |:..:.|.|  :.....||:    .||       |...|     
  Rat   200 KGLKLIIDFI-----------PNHTSDKHPWFQSSRTRSGKYTDYYIWHNCTHANGVTTPPNNWL 253

  Fly   274 --YSTDNDDLEDDLELAY------------------DEEI-EI----LSEAEQATPYDFI--LSE 311
              |...:...:::.:..|                  .||| ||    ||:......:|.:  |.|
  Rat   254 SVYGNSSWQFDEERKQCYFHQFLKEQPDLNFRNPAVQEEIKEIIKFWLSKGVDGFSFDAVKFLLE 318

  Fly   312 ATARQDLEPPQQLQVTTTTPATSEEIIHTIARVNPVVEESSSLPGDSVPSAAISDKLLTTVIANM 376
            |   :||.  .::||.|:      :|..|:.|.:.:..:                  .||....|
  Rat   319 A---KDLR--NEIQVNTS------QIPDTVTRYSELYHD------------------FTTTQVGM 354

  Fly   377 ETVLQQSRELQAQIHHEQEQEREQRSTQPANSLLAKAQMLLDGLS 421
            ..:::..|:...|...|..:.|...:...|.|  .:..|:..|||
  Rat   355 HDLVRDFRQTMNQFSREPGRYRFMGTEVSAES--TERTMVYYGLS 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10949NP_001286101.1 MADF 5..91 CDD:214738
MADF 140..226 CDD:214738
Slc3a1NP_058912.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..50
AmyAc_SLC3A1 113..566 CDD:200494 47/240 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.