DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10949 and Slc3a1

DIOPT Version :9

Sequence 1:NP_001286101.1 Gene:CG10949 / 35310 FlyBaseID:FBgn0032858 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_033231.2 Gene:Slc3a1 / 20532 MGIID:1195264 Length:685 Species:Mus musculus


Alignment Length:228 Identity:44/228 - (19%)
Similarity:74/228 - (32%) Gaps:65/228 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 KGVPLVLENIKRR--GRPP---KAGNPSGK---------------TSKQPEGMVISSGEQIWGAD 271
            ||:.|:::.|...  .:.|   .:...|||               .:..|...:...|...|..|
Mouse   202 KGLKLIIDFIPNHTSDKHPWFQSSRTRSGKYTDYYIWHNCTHVNGVTTPPNNWLSVYGNSSWHFD 266

  Fly   272 --------YPYSTDNDDLEDDLELAYDEEIEI----LSEAEQATPYDFI--LSEATARQDLEPPQ 322
                    :.:..:..||........:|..||    ||:......:|.:  |.||   :||.  .
Mouse   267 EVRKQCYFHQFLKEQPDLNFRNPAVQEEIKEIITFWLSKGVDGFSFDAVKFLLEA---KDLR--N 326

  Fly   323 QLQVTTTTPATSEEIIHTIARVNPVVEESSSLPGDSVPSAAISDKLLTTVIANMETVLQQSRELQ 387
            ::||.|             :::...|...|.|..|           .||....|..:::..|:..
Mouse   327 EIQVNT-------------SQIPDTVTHYSELYHD-----------FTTTQVGMHDIVRDFRQTM 367

  Fly   388 AQIHHEQEQEREQRSTQPANSLLAKAQMLLDGL 420
            .|...|..:.|...:...|.|:  :..|:..||
Mouse   368 NQYSREPGRYRFMGAEASAESI--ERTMMYYGL 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10949NP_001286101.1 MADF 5..91 CDD:214738
MADF 140..226 CDD:214738
Slc3a1NP_033231.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..53
SLC3A2_N 64..122 CDD:292647
AmyAc_SLC3A1 115..568 CDD:200494 44/228 (19%)
trehalose_treC 116..604 CDD:274115 44/228 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.