DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10949 and C50B6.7

DIOPT Version :9

Sequence 1:NP_001286101.1 Gene:CG10949 / 35310 FlyBaseID:FBgn0032858 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_506303.1 Gene:C50B6.7 / 179813 WormBaseID:WBGene00008220 Length:713 Species:Caenorhabditis elegans


Alignment Length:140 Identity:29/140 - (20%)
Similarity:49/140 - (35%) Gaps:41/140 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 KLRDRFGREFRSHQINQSTPITWRYFNDLLFLGRHFRKGVPLVLENIKRR--GRPPKAGNPSGKT 252
            ||..|.|.|              :.|.|:  :.|..:.||.::::.:...  |...|:||..|  
 Worm    90 KLDSRSGNE--------------QEFQDM--VNRCNKVGVRIIVDIVMNHMVGIGQKSGNGVG-- 136

  Fly   253 SKQPEGMVISSGEQIWGADY--------PYST---DNDDLEDDLELA-YDEEIEILSEAEQATPY 305
                     |||...:...:        |||.   :|...:.|::.: |....|.:.:.......
 Worm   137 ---------SSGSSSFDGTHGVQSFPGVPYSLGDFNNPKCDGDIQGSDYQNSAEHVKDCRLVGLL 192

  Fly   306 DFILSEATAR 315
            |...:.||.|
 Worm   193 DLNQASATVR 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10949NP_001286101.1 MADF 5..91 CDD:214738
MADF 140..226 CDD:214738 8/35 (23%)
C50B6.7NP_506303.1 AmyAc_bac_euk_AmyA 31..421 CDD:200456 29/140 (21%)
AmyA 53..>354 CDD:223443 29/140 (21%)
Aamy_C 432..511 CDD:214749
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.