powered by:
Protein Alignment CG10949 and R01B10.3
DIOPT Version :9
Sequence 1: | NP_001286101.1 |
Gene: | CG10949 / 35310 |
FlyBaseID: | FBgn0032858 |
Length: | 459 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_504566.1 |
Gene: | R01B10.3 / 178991 |
WormBaseID: | WBGene00019805 |
Length: | 98 |
Species: | Caenorhabditis elegans |
Alignment Length: | 31 |
Identity: | 6/31 - (19%) |
Similarity: | 11/31 - (35%) |
Gaps: | 14/31 - (45%) |
- Green bases have known domain annotations that are detailed below.
Fly 20 DCARSVK--------------NAAQKDAAWK 36
||.:..| ||.:::..|:
Worm 21 DCVKQRKVAEVPQIGYSLDELNAKREEPKWR 51
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG10949 | NP_001286101.1 |
MADF |
5..91 |
CDD:214738 |
6/31 (19%) |
MADF |
140..226 |
CDD:214738 |
|
R01B10.3 | NP_504566.1 |
SLC3A2_N |
35..>79 |
CDD:374310 |
3/17 (18%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0366 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.