Sequence 1: | NP_001286101.1 | Gene: | CG10949 / 35310 | FlyBaseID: | FBgn0032858 | Length: | 459 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_492896.1 | Gene: | madf-2 / 173019 | WormBaseID: | WBGene00009461 | Length: | 290 | Species: | Caenorhabditis elegans |
Alignment Length: | 264 | Identity: | 60/264 - (22%) |
---|---|---|---|
Similarity: | 95/264 - (35%) | Gaps: | 76/264 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 141 LIELVKSHPVLYDRHKIRVSKNLAAKNEAWREISENLNVSEEL-----C---YNRWKKLRDRFGR 197
Fly 198 EFR-----SHQINQSTPITWRYFNDLLFLGRHFRKGVPLVLE-------NIKRRGR--------- 241
Fly 242 --------------PPKAGNPS-------GKTSKQPE-----GMVISSGEQIWGADY-PYSTDN- 278
Fly 279 --DDLEDDLELAYDEEIEILSEAEQATPYDFILSEATARQDLEPPQQLQVTTTTP-ATSEEIIHT 340
Fly 341 IARV 344 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10949 | NP_001286101.1 | MADF | 5..91 | CDD:214738 | |
MADF | 140..226 | CDD:214738 | 24/97 (25%) | ||
madf-2 | NP_492896.1 | MADF | 11..107 | CDD:214738 | 24/94 (26%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR12243 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |