DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10949 and madf-2

DIOPT Version :9

Sequence 1:NP_001286101.1 Gene:CG10949 / 35310 FlyBaseID:FBgn0032858 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_492896.1 Gene:madf-2 / 173019 WormBaseID:WBGene00009461 Length:290 Species:Caenorhabditis elegans


Alignment Length:264 Identity:60/264 - (22%)
Similarity:95/264 - (35%) Gaps:76/264 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 LIELVKSHPVLYDRHKIRVSKNLAAKNEAWREISENLNVSEEL-----C---YNRWKKLRDRFGR 197
            ||..:::.||::|::....|.....|....||::..||...::     |   .::||.|:|.|.|
 Worm    12 LINAIRNRPVIWDKNYFGESNYRTLKTSCLREVTSELNSMFQMPIKFTCEDVRSQWKNLKDTFVR 76

  Fly   198 EFR-----SHQINQSTPITWRYFNDLLFLGRHFRKGVPLVLE-------NIKRRGR--------- 241
            :.|     .:..:.....||:::..|.||.....|.:....|       |....|:         
 Worm    77 KLRWVHEGKYMEDAMKEPTWKFYRMLTFLDEKEAKRLGDTCEHTYELAPNSTSCGQRAQISYEPT 141

  Fly   242 --------------PPKAGNPS-------GKTSKQPE-----GMVISSGEQIWGADY-PYSTDN- 278
                          ||:....|       ...|.:|:     ..|.||.....|..| |..:.| 
 Worm   142 STEEKMFQMFNNQPPPQLSQQSMIDSSQIATCSNEPKMTSSSTFVTSSTSLKRGVHYSPTRSPNG 206

  Fly   279 --DDLEDDLELAYDEEIEILSEAEQATPYDFILSEATARQDLEPPQQLQVTTTTP-ATSEEIIHT 340
              ..||::||   ||:       ||..      .:.:.|:.:...|.:||.||.| |..:|..|.
 Worm   207 SSSGLEEELE---DED-------EQPG------RKKSCRRQVSNIQPMQVITTPPVAHQDEFDHF 255

  Fly   341 IARV 344
            .|.|
 Worm   256 GAMV 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10949NP_001286101.1 MADF 5..91 CDD:214738
MADF 140..226 CDD:214738 24/97 (25%)
madf-2NP_492896.1 MADF 11..107 CDD:214738 24/94 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.