DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10949 and Slc3a2

DIOPT Version :9

Sequence 1:NP_001286101.1 Gene:CG10949 / 35310 FlyBaseID:FBgn0032858 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_001154885.1 Gene:Slc3a2 / 17254 MGIID:96955 Length:565 Species:Mus musculus


Alignment Length:160 Identity:38/160 - (23%)
Similarity:63/160 - (39%) Gaps:45/160 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 VSKNLAAKNEAWREISENLNVSEELCYNRWKKLRDRFGREFRS------HQINQSTPITWRYFND 217
            ||.|:..|.:         |........::::|.|..|:| ||      |.::.|.        |
Mouse   435 VSLNMTVKGQ---------NEDPGSLLTQFRRLSDLRGKE-RSLLHGDFHALSSSP--------D 481

  Fly   218 LLFLGRHFRKGVP-LVLENIKRRGRPPKAGNPSGKTSKQPEGMVISSGEQIWGADYPYSTDN--D 279
            |....||:.:... ||:.|.:..||..:.|     .|..|.|:.:.:..::.     .|||:  .
Mouse   482 LFSYIRHWDQNERYLVVLNFRDSGRSARLG-----ASNLPAGISLPASAKLL-----LSTDSARQ 536

  Fly   280 DLEDDLELAYDEEIEILSEAEQATPYDFIL 309
            ..|:|..|    ::|.||    ..||:.:|
Mouse   537 SREEDTSL----KLENLS----LNPYEGLL 558

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10949NP_001286101.1 MADF 5..91 CDD:214738
MADF 140..226 CDD:214738 17/72 (24%)
Slc3a2NP_001154885.1 SLC3A2_N 85..156 CDD:292647
AmyAc_family 139..468 CDD:298606 10/42 (24%)
AmyA 169..513 CDD:223443 23/100 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.