DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10949 and Amy1

DIOPT Version :9

Sequence 1:NP_001286101.1 Gene:CG10949 / 35310 FlyBaseID:FBgn0032858 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_001103975.1 Gene:Amy1 / 11722 MGIID:88019 Length:511 Species:Mus musculus


Alignment Length:82 Identity:17/82 - (20%)
Similarity:35/82 - (42%) Gaps:18/82 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 NEAWREISENLNV---SEELCYNRWKKLRDRF-------GREFRSHQINQSTPITWR-------- 213
            |...:|:|.|.:.   ::.:|.:||:::|:..       |:.|.:...|.|..:.:.        
Mouse   379 NGKTKEVSINPDSTCGNDWICEHRWRQIRNMVAFRNVVNGQPFANWWDNDSNQVAFGRGNKGFIV 443

  Fly   214 YFNDLLFLGRHFRKGVP 230
            :.||...|....:.|:|
Mouse   444 FNNDDWALSETLQTGLP 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10949NP_001286101.1 MADF 5..91 CDD:214738
MADF 140..226 CDD:214738 15/76 (20%)
Amy1NP_001103975.1 AmyAc_bac_euk_AmyA 25..416 CDD:200456 8/36 (22%)
AmyA 46..>315 CDD:223443
Aamy_C 422..510 CDD:214749 7/39 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.