DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10949 and Amy2a5

DIOPT Version :9

Sequence 1:NP_001286101.1 Gene:CG10949 / 35310 FlyBaseID:FBgn0032858 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_001036176.1 Gene:Amy2a5 / 109959 MGIID:88020 Length:508 Species:Mus musculus


Alignment Length:228 Identity:37/228 - (16%)
Similarity:73/228 - (32%) Gaps:77/228 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 KLGASERACITRWKSIRDRFGKEFRRFQERPDEPTYWDMFP---RLLFLKDHYKQGLARNESLDG 102
            |.||.....|.:|...:..:.|.:..         .|.:.|   .|:|:.:|..|   |.....|
Mouse   269 KYGAKLGTVIRKWNGEKMSYLKNWGE---------GWGLVPSDRALVFVDNHDNQ---RGHGAGG 321

  Fly   103 ---MRFEPRERKKRTKVDMEQERRRKDEEEEDSQDDLLNEQLIELVKSHPVLYDR--HKIRVSKN 162
               :.|                           .|..:.:..:..:.:||..:.|  ...|.::|
Mouse   322 SSILTF---------------------------WDARMYKMAVGFMLAHPYGFTRVMSSYRWNRN 359

  Fly   163 L------------AAKNEAWREISENLNV---SEELCYNRWKKLRDRF-------GREFRSHQIN 205
            .            ...|...:|::.|.:.   ::.:|.:||:::|:..       |:.|.:...|
Mouse   360 FQNGKDQNDWIGPPNNNGVTKEVTINADTTCGNDWVCEHRWRQIRNMVAFRNVVNGQPFSNWWDN 424

  Fly   206 QSTPITWR--------YFNDLLFLGRHFRKGVP 230
            .|..:.:.        :.||...|....:.|:|
Mouse   425 NSNQVAFSRGNRGFIVFNNDDWALSATLQTGLP 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10949NP_001286101.1 MADF 5..91 CDD:214738 11/52 (21%)
MADF 140..226 CDD:214738 19/117 (16%)
Amy2a5NP_001036176.1 AmyAc_bac_euk_AmyA 25..413 CDD:200456 28/182 (15%)
AmyA 46..>344 CDD:223443 16/113 (14%)
Aamy_C 420..507 CDD:214749 7/38 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.