DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10949 and si:zfos-128g4.1

DIOPT Version :9

Sequence 1:NP_001286101.1 Gene:CG10949 / 35310 FlyBaseID:FBgn0032858 Length:459 Species:Drosophila melanogaster
Sequence 2:XP_002661969.1 Gene:si:zfos-128g4.1 / 100334256 ZFINID:ZDB-GENE-141212-382 Length:248 Species:Danio rerio


Alignment Length:311 Identity:67/311 - (21%)
Similarity:118/311 - (37%) Gaps:76/311 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 NEQLIELVKSHPVLYD--RHKIRVSKNLAAKNEAWREISENLNVSEELCYNRWKKLRDRFGREFR 200
            :|:||:.|.:.||||:  .|..|.::.   :.:||||::.::.:|...|..|||.:|||:.||.|
Zfish     6 SEKLIQTVYAFPVLYNVSLHDYRSTER---RVKAWREVAASVGLSVVECKRRWKTIRDRYIRERR 67

  Fly   201 SHQINQSTP----ITWRYFNDLLFLGRHFRKGVPLVLENIKRRGRPPKAGNPSGKTSKQPEGMVI 261
            ..::.:...    ..|.:...|.||..|.||           |.||..|..|..:..::..... 
Zfish    68 LCKLKKDLGGRRLHYWPHRESLAFLDAHIRK-----------RRRPSGAQGPEEEQQEEHSSAA- 120

  Fly   262 SSGEQIWGADYPYSTDNDDLEDDLELAYDEEIEILSEAEQATPYDFILSEATARQDLEPPQQLQV 326
                               |::|.|...:|.::..|.. ..:|....:..|      .||.||: 
Zfish   121 -------------------LQEDKECVSEECVDSGSRL-AVSPLPVSIMSA------PPPPQLK- 158

  Fly   327 TTTTPATSEEIIHTIARVNPVVEESSSLPGDSVPSAAISDKLLTTVIANMETVLQQSRELQAQIH 391
                         .:.:|:|::            .||:...|....:.:..|....:..|...: 
Zfish   159 -------------AVPQVSPLL------------LAALPPGLKVAPVCSSATGSASAGPLNVPL- 197

  Fly   392 HEQEQEREQRSTQPANSLLAKAQMLLDGLSPSERASAERKIVQFLCQCQIK 442
              :||:|...:.......|......|..|:|.:||:.:.:|.|.:...:.|
Zfish   198 --EEQQRADGALDEDQLFLLSYVPALKRLTPQKRAAVKMQIQQIMFNAEFK 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10949NP_001286101.1 MADF 5..91 CDD:214738
MADF 140..226 CDD:214738 29/91 (32%)
si:zfos-128g4.1XP_002661969.1 MADF 8..97 CDD:214738 29/91 (32%)
BESS 208..242 CDD:281011 8/33 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1634040at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.