DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10947 and Mettl21c

DIOPT Version :10

Sequence 1:NP_610031.1 Gene:CG10947 / 35309 FlyBaseID:FBgn0032857 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001013821.1 Gene:Mettl21c / 433294 MGIID:3611450 Length:248 Species:Mus musculus


Alignment Length:149 Identity:37/149 - (24%)
Similarity:63/149 - (42%) Gaps:24/149 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 NTGNICVWPSEEALTALV--LSEVASYRGKWILEL--GGGFTSLAGLMLAKYATPYAVHLTDGNE 266
            |.|.: |||...||...:  .:|..:.:...|||:  |.|..|:...:|....|  |..|.|   
Mouse    70 NYGTV-VWPGATALCQYLEDHTEELNLQDAKILEIGAGAGLVSIVSSLLGAQVT--ATDLPD--- 128

  Fly   267 ISVENVRKTVCLNELSC---YTKCSVLKWQEKSARS-QAEQAKFDFILCADCL----FFDEARSA 323
             .:.|::..:..|.|.|   ..:...|.|.|...:| ......:|::|.:|.:    |.|:..:.
Mouse   129 -VLGNLQYNILKNTLECTAHLPEVRELVWGEDLEQSFPKSTCCYDYVLASDVVYHHYFLDKLLAT 192

  Fly   324 LVDTIWYYLAPEGSALIMA 342
            :|     ||:..|:.::.|
Mouse   193 MV-----YLSQPGTVVLWA 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10947NP_610031.1 AdoMet_MTases 199..352 CDD:473071 37/149 (25%)
Mettl21cNP_001013821.1 AdoMet_MTases 56..224 CDD:473071 37/149 (25%)

Return to query results.
Submit another query.