DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A1 and AT1G51210

DIOPT Version :9

Sequence 1:NP_523607.2 Gene:Ugt37A1 / 35307 FlyBaseID:FBgn0026756 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_175532.1 Gene:AT1G51210 / 841544 AraportID:AT1G51210 Length:433 Species:Arabidopsis thaliana


Alignment Length:462 Identity:80/462 - (17%)
Similarity:156/462 - (33%) Gaps:147/462 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 IYGAQGANILGLFPSLSPSHLIISMSVAKILAEQGHNVTVVTV------LEPTIT-HKN-INLVT 75
            |.|:...:|: :||..:..||:..:.:...|..:|..|:::..      |.|.:: |.: :::||
plant    13 IRGSLKPHIM-VFPYPAQGHLLPLLDLTHQLCLRGLTVSIIVTPKNLPYLSPLLSAHPSAVSVVT 76

  Fly    76 VPMTKEEIKQRSETIGAKQKNTSSNRFISILNMSGQMDSMLRKMADVLKDQRVKELYLNKDNHFD 140
            :|.....:      |.:..:|        :.::.|..:.::......|::..|..|..:.:....
plant    77 LPFPHHPL------IPSGVEN--------VKDLGGYGNPLIMASLRQLREPIVNWLSSHPNPPVA 127

  Fly   141 LVISGYFMNDYQLGFARKVNAPVVV--------------------LAPSPPSQMLNSLIGNPHDK 185
            |:      :|:.||:.:.:..|...                    |..|.....|:.|..:|..|
plant   128 LI------SDFFLGWTKDLGIPRFAFFSSGAFLASILHFVSDKPHLFESTEPVCLSDLPRSPVFK 186

  Fly   186 VEKEKGM----TFGQRLDSYISSLL----YGIFLRQIDQRNRQYY---------NEIFG------ 227
            .|....:    ...|.|:|...|.:    ||......:.....|.         |.:||      
plant   187 TEHLPSLIPQSPLSQDLESVKDSTMNFSSYGCIFNTCECLEEDYMEYVKQKVSENRVFGVGPLSS 251

  Fly   228 ------------DDPTMPEYTDILRNTSLVFFCSHAASEGPIRPSVPAAIEIGGIQIKDKPDPLP 280
                        |...:..:.|...:.|:::.|..:..                :..|::.|.|.
plant   252 VGLSKEDSVSNVDAKALLSWLDGCPDDSVLYICFGSQK----------------VLTKEQCDDLA 300

  Fly   281 KNLEKFLGNATHGAILLSLGSNVQGSHIKADTVKKIFSVLSNLKQRVIW--KWDDL-----DKTP 338
            ..|||.:                                     .|.:|  |.|.:     |:..
plant   301 LGLEKSM-------------------------------------TRFVWVVKKDPIPDGFEDRVA 328

  Fly   339 GKSDNILYSRWLPQDDILAHPSVKLFINHAGKGGISEAQYHGKPMLSLPVFGDQPGNAHAMVKSG 403
            |:  .::...|.||..:|:|.:|..|:.|.|...:.||...|..:|:.|:..||..:|..:|:. 
plant   329 GR--GMIVRGWAPQVAMLSHVAVGGFLIHCGWNSVLEAMASGTMILAWPMEADQFVDARLVVEH- 390

  Fly   404 FGLTLSL 410
            .|:.:|:
plant   391 MGVAVSV 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A1NP_523607.2 GT1_Gtf-like 25..456 CDD:340817 78/456 (17%)
AT1G51210NP_175532.1 Glycosyltransferase_GTB-type 18..432 CDD:385653 78/457 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.