DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A1 and UGT85A7

DIOPT Version :9

Sequence 1:NP_523607.2 Gene:Ugt37A1 / 35307 FlyBaseID:FBgn0026756 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_173652.1 Gene:UGT85A7 / 838841 AraportID:AT1G22340 Length:487 Species:Arabidopsis thaliana


Alignment Length:559 Identity:108/559 - (19%)
Similarity:197/559 - (35%) Gaps:177/559 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LIYGAQGANILGLFPSLSPSHLIISMSVAKILAEQGHNVTVVTVLE-----------------PT 65
            :::.||..::: ..|..:..|:...:.|||:|..:|.:||.|..|.                 |:
plant     5 VVHNAQKPHVV-CVPYPAQGHINPMLKVAKLLYAKGFHVTFVNTLYNHNRLLRSRGPNALDGFPS 68

  Fly    66 ITHKNI-------------NLVTVPMTKE--------EIKQR-------------------SETI 90
            ...::|             :..||.|:.|        ||.:|                   |.|:
plant    69 FRFESIPDGLPETDGDRTQHTPTVCMSIEKNCLAPFKEILRRINDKDDVPPVSCIVSDGVMSFTL 133

  Fly    91 GAKQK---------NTSSNRFISILNMSGQMDSMLRKMADVLKDQRVKELYLNKDNHFDLVISGY 146
            .|.::         ..|:..|::||:..    ..:.|.....||    |.|::|: |.|.||   
plant   134 DAAEELGVPEVIFWTNSACGFMTILHFY----LFIEKGLSPFKD----ESYMSKE-HLDTVI--- 186

  Fly   147 FMNDY--QLGFARKVNAPVVVLAPSPPSQMLNSLIGNPHDKVEKEKGM------TFGQRLDSYIS 203
               |:  .:...|..:.|..:...:|.:.|||.||    .:||:.|..      ||.:.....|.
plant   187 ---DWIPSMKNLRLKDIPSYIRTTNPDNIMLNFLI----REVERSKRASAIILNTFDELEHDVIQ 244

  Fly   204 SL------------LYGIFLRQIDQRNR--QYYNEIFGDDPTMPEYTDILRNTSLVFFCSHAASE 254
            |:            |:.:...:|::.:.  |....::.::....::.|.....|::|        
plant   245 SMQSILPPVYSIGPLHLLVKEEINEASEIGQMGLNLWREEMECLDWLDTKTPNSVLF-------- 301

  Fly   255 GPIRPSVPAAIEIGGIQIKDKPDPLPKNLEKFLGNATHGAILLSLGSNVQGSHIKADTVKKIFSV 319
                      :..|.|.:..     .|.||:|...                  :.|...:.::.:
plant   302 ----------VNFGCITVMS-----AKQLEEFAWG------------------LAASRKEFLWVI 333

  Fly   320 LSNL---KQRVIWKWDDLDKTPGKSDNILYSRWLPQDDILAHPSVKLFINHAGKGGISEAQYHGK 381
            ..||   :..|:...:.|.:|   .|..:.:.|.||:.:|:||::..|:.|.|.....|:...|.
plant   334 RPNLVVGEAMVVLPQEFLAET---IDRRMLASWCPQEKVLSHPAIGGFLTHCGWNSTLESLAGGV 395

  Fly   382 PMLSLPVFGDQPGNAHAMVKS-GFGLTLSLLTLEEEPFRAAVLEILSNPKYSQRVVKFSSLYRDR 445
            ||:..|.|.:||.|....... |.|:.:. ..::.|.....|.|::...|..:            
plant   396 PMICWPCFSEQPTNCKFCCDEWGVGIEIG-KDVKREEVETVVRELMDGEKGKK------------ 447

  Fly   446 PASARESLIFW---TEYVIRH-HGAAHLQ-SPLVHMDFI 479
               .||....|   .|...|: ||::.:. ..|:|..|:
plant   448 ---LREKAEEWRRLAEEATRYKHGSSVMNLETLIHKVFL 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A1NP_523607.2 GT1_Gtf-like 25..456 CDD:340817 98/522 (19%)
UGT85A7NP_173652.1 Glycosyltransferase_GTB-type 12..481 CDD:385653 105/548 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.