DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A1 and AT1G10400

DIOPT Version :9

Sequence 1:NP_523607.2 Gene:Ugt37A1 / 35307 FlyBaseID:FBgn0026756 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_172511.3 Gene:AT1G10400 / 837580 AraportID:AT1G10400 Length:467 Species:Arabidopsis thaliana


Alignment Length:419 Identity:88/419 - (21%)
Similarity:160/419 - (38%) Gaps:83/419 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LFPSLSPSHLIISMSVAKILAEQGH----NVTVVTV------LEPTITHKNINLVTVPMTKE--E 82
            |||.||..|:|..:.:|::|.....    :|||.|.      :..:::.....:|.||....  |
plant    10 LFPYLSKGHMIPMLQLARLLLSHSFAGDISVTVFTTPLNRPFIVDSLSGTKATIVDVPFPDNVPE 74

  Fly    83 IKQRSETIGAKQKNTSSNRFISILNMSGQMDSMLRKMADVLKDQRVKELYLNKDNHFDLVISGYF 147
            |....|... |....||:.|:.....:..|.:...:  :::...||           ..::|..|
plant    75 IPPGVECTD-KLPALSSSLFVPFTRATKSMQADFER--ELMSLPRV-----------SFMVSDGF 125

  Fly   148 M-----NDYQLGFARKV----NAPVVVLAPSPPSQMLNSLIGNPHDKVEKEKGMTF---GQRLDS 200
            :     :..:|||.|.|    |....|:.   .|...|.|:.|...:.|......|   ..|...
plant   126 LWWTQESARKLGFPRLVFFGMNCASTVIC---DSVFQNQLLSNVKSETEPVSVPEFPWIKVRKCD 187

  Fly   201 YISSLL---------YGIFLRQIDQRNRQYYNEIFGD-DPTMPEYTDIL-RNTSLVFFCSHAASE 254
            ::..:.         :.:.|.|:...| |....||.. |...|.:.|.. |...|..:     :.
plant   188 FVKDMFDPKTTTDPGFKLILDQVTSMN-QSQGIIFNTFDDLEPVFIDFYKRKRKLKLW-----AV 246

  Fly   255 GPIRPSVPAAIEIGGI---QIKDKPDPLPKNLEKFLGNATH---GAILLSLGSNVQGSHIKADTV 313
            ||:       ..:...   ::::|..|   :..|:|.....   ..:.::.||..:   |..:.:
plant   247 GPL-------CYVNNFLDDEVEEKVKP---SWMKWLDEKRDKGCNVLYVAFGSQAE---ISREQL 298

  Fly   314 KKIFSVLSNLKQRVIW--KWDDLDK----TPGKSDNILYSRWLPQDDILAHPSVKLFINHAGKGG 372
            ::|...|...|...:|  |.:::.|    ..|:...::...|:.|..||.|.||:.|::|.|...
plant   299 EEIALGLEESKVNFLWVVKGNEIGKGFEERVGERGMMVRDEWVDQRKILEHESVRGFLSHCGWNS 363

  Fly   373 ISEAQYHGKPMLSLPVFGDQPGNAHAMVK 401
            ::|:.....|:|:.|:..:||.||..:|:
plant   364 LTESICSEVPILAFPLAAEQPLNAILVVE 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A1NP_523607.2 GT1_Gtf-like 25..456 CDD:340817 88/419 (21%)
AT1G10400NP_172511.3 Glycosyltransferase_GTB_type 5..459 CDD:299143 88/419 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2282
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.