DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A1 and UGT71C3

DIOPT Version :9

Sequence 1:NP_523607.2 Gene:Ugt37A1 / 35307 FlyBaseID:FBgn0026756 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_172206.1 Gene:UGT71C3 / 837237 AraportID:AT1G07260 Length:476 Species:Arabidopsis thaliana


Alignment Length:528 Identity:97/528 - (18%)
Similarity:187/528 - (35%) Gaps:170/528 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 AQGANILGLFPSLSPSHLIISMSVAKILAEQGHNVTVVTVL--------------------EPTI 66
            |:...|...:|  ||.||::|:..||.|.::...:..:|:|                    :|.|
plant     3 AEAEIIFVTYP--SPGHLLVSIEFAKSLIKRDDRIHTITILYWALPLAPQAHLFAKSLVASQPRI 65

  Fly    67 ----------------------------THKNINLVTVPMTKEEIKQRSETIGAKQKNTSSNRFI 103
                                        |.|     |||:.::.:    .|:.:.:|.:.|.|.:
plant    66 RLLALPDVQNPPPLELFFKAPEAYILESTKK-----TVPLVRDAL----STLVSSRKESGSVRVV 121

  Fly   104 SILNMSGQMDSMLRKMADVLKDQRVKELYLNKDNHFDLVISGYFMNDYQLGFARKVNAPVVVLAP 168
            .::     :|.....|.:|..:       ||..::..|..:..|::                   
plant   122 GLV-----IDFFCVPMIEVANE-------LNLPSYIFLTCNAGFLS------------------- 155

  Fly   169 SPPSQMLNSLIGNPHDKVEKEKGMTFG---QRLDSYISS-----LLYGIFLRQIDQRNRQYYNEI 225
                  :...:...|.....|..::.|   ..:..|:.|     |..|:|:|:..:...:...:.
plant   156 ------MMKYLPERHRITTSELDLSSGNVEHPIPGYVCSVPTKVLPPGLFVRESYEAWVEIAEKF 214

  Fly   226 FGDDPTMPEYTDILRNTSLVFFCSHAASEGPIRPSVPAAIEIGGIQIKDKPDPLPKNLE------ 284
            .|....:......|...:..:|.....:..|:.|..|.      :.:||:|.|   ||:      
plant   215 PGAKGILVNSVTCLEQNAFDYFARLDENYPPVYPVGPV------LSLKDRPSP---NLDASDRDR 270

  Fly   285 --KFLGNATHGAILL----SLG--SNVQGSHIKADTVKKIFSVLSNLKQRVIWK----------- 330
              ::|.:....:|:.    |||  ..:|        :::|...|.....|.:|.           
plant   271 IMRWLEDQPESSIVYICFGSLGIIGKLQ--------IEEIAEALELTGHRFLWSIRTNPTEKASP 327

  Fly   331 WD-----DLDKTPGKSDNILYSRWLPQDDILAHPSVKLFINHAGKGGISEAQYHGKPMLSLPVFG 390
            :|     .||:|..|.   |...|.||.::|||.::..|::|.|...:.|:.:.|.|:.:.|::.
plant   328 YDLLPEGFLDRTASKG---LVCDWAPQVEVLAHKALGGFVSHCGWNSVLESLWFGVPIATWPMYA 389

  Fly   391 DQPGNAHAMVKSGFGLTLSLL---------TLEEEPFRAAVLEILSNPKYSQRVVKFSSLYRDRP 446
            :|..||.:|||. .||.:.|.         .::.|....|:..::......::.||      :..
plant   390 EQQLNAFSMVKE-LGLAVELRLDYVSAYGEIVKAEEIAGAIRSLMDGEDTPRKRVK------EMA 447

  Fly   447 ASARESLI 454
            .:||.:|:
plant   448 EAARNALM 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A1NP_523607.2 GT1_Gtf-like 25..456 CDD:340817 96/525 (18%)
UGT71C3NP_172206.1 PLN02167 2..476 CDD:215112 97/528 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.