DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A1 and AT5G37950

DIOPT Version :9

Sequence 1:NP_523607.2 Gene:Ugt37A1 / 35307 FlyBaseID:FBgn0026756 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_198611.1 Gene:AT5G37950 / 833774 AraportID:AT5G37950 Length:351 Species:Arabidopsis thaliana


Alignment Length:309 Identity:57/309 - (18%)
Similarity:96/309 - (31%) Gaps:129/309 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 KVEKEKGMTFGQRLDSY-------ISSLLYGIFLRQIDQRNRQYYNEIFGDDPTMPEYTDILRNT 242
            |:.||..::|.:.|..:       |:.::|..|:         |:.|....:..:|:......|.
plant    59 KLNKECEISFKKCLGQFLLQQQEEIACVIYDEFM---------YFAEAAAKEFNLPKVIFSTENA 114

  Fly   243 SLVFFCSHA-----ASEGPIRP----------SVPAAIEIGGIQIKDKPD----PLPKNLEKFLG 288
            : .|.|..|     |.:| |.|          .||   |:..::.||.|.    |:..::|.|..
plant   115 T-AFACRSAMCKLYAKDG-IAPLTEGCGREEELVP---ELHPLRYKDLPTSAFAPVEASVEVFKS 174

  Fly   289 NATHG------------------------------------------------------------ 293
            :...|                                                            
plant   175 SCEKGTASSMIINTVSCLEISSLEWLQQELKIPIYPIGPLYMVSSAPPTSLLDENESCIDWLNKQ 239

  Fly   294 ----AILLSLGSNVQGSHIKADTVKKIFSVLSNLKQRVIWKWDDLDKTPGK------SDNILYS- 347
                .|.:||||   .:.::...|.::.|.|.:..|..:|.     ..||.      |:..|:| 
plant   240 KPSSVIYISLGS---FTLLETKEVLEMASGLVSSNQYFLWA-----IRPGSILGSELSNEELFSM 296

  Fly   348 ----------RWLPQDDILAHPSVKLFINHAGKGGISEAQYHGKPMLSL 386
                      :|..|..:|||.:|..|.:|.|.....|:...|.|::.|
plant   297 MEIPDRGYIVKWATQKQVLAHAAVGAFWSHCGWNSTLESIGEGIPIVGL 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A1NP_523607.2 GT1_Gtf-like 25..456 CDD:340817 57/309 (18%)
AT5G37950NP_198611.1 Glycosyltransferase_GTB_type 1..343 CDD:299143 56/305 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.