DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A1 and AT5G03490

DIOPT Version :9

Sequence 1:NP_523607.2 Gene:Ugt37A1 / 35307 FlyBaseID:FBgn0026756 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_195969.1 Gene:AT5G03490 / 831823 AraportID:AT5G03490 Length:465 Species:Arabidopsis thaliana


Alignment Length:469 Identity:95/469 - (20%)
Similarity:160/469 - (34%) Gaps:164/469 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LLIYGAQGANI----LGLFPSLSPSHLIISMSVAKILAEQGHNVTVV------TVLEPTIT-H-K 69
            ||:.|.:..|.    :.:||..:..||:..:.:...|..:|.||:|:      |.|.|.:: | .
plant     5 LLLPGTKSENSKPPHIVVFPFPAQGHLLPLLDLTHQLCLRGFNVSVIVTPGNLTYLSPLLSAHPS 69

  Fly    70 NINLVTVPMTKEEIKQRSETIGAKQKNTSSNRFISILNMSGQMDSM--LRKMADVLKDQRVKELY 132
            ::..|..|.....    |.:.|.:......|        ||.:..|  ||::.     :.:...:
plant    70 SVTSVVFPFPPHP----SLSPGVENVKDVGN--------SGNLPIMASLRQLR-----EPIINWF 117

  Fly   133 LNKDNHFDLVISGYFM---NDY--QLGFAR------------------------KVNAPVVVL-- 166
            .:..|....:||.:|:   :|.  |:|..|                        |...|:.:|  
plant   118 QSHPNPPIALISDFFLGWTHDLCNQIGIPRFAFFSISFFLVSVLQFCFENIDLIKSTDPIHLLDL 182

  Fly   167 --APSPPSQMLNSLI----GNPHDKVEKEKGMTFGQRLDSY-----ISSLLYGIFLRQIDQR--- 217
              ||....:.|.|::    ..|...:|..|  .|...|.||     .|.:|...:|:.:.||   
plant   183 PRAPIFKEEHLPSIVRRSLQTPSPDLESIK--DFSMNLLSYGSVFNSSEILEDDYLQYVKQRMGH 245

  Fly   218 NRQYYNEIFGD---------------DPTMPEYTDILRNTSLVFFCSHAASEGPIRPSVPAAIEI 267
            :|.|   :.|.               ||::..:.|...|.|:::.|.                  
plant   246 DRVY---VIGPLCSIGSGLKSNSGSVDPSLLSWLDGSPNGSVLYVCF------------------ 289

  Fly   268 GGIQ---IKDKPDPLPKNLEKFLGNATHGAILLSLGSNVQGSHIKADTVKKIFSVLSNLKQRVIW 329
             |.|   .||:.|.|...|||.:                                     .|.:|
plant   290 -GSQKALTKDQCDALALGLEKSM-------------------------------------TRFVW 316

  Fly   330 --KWDDL-----DKTPGKSDNILYSRWLPQDDILAHPSVKLFINHAGKGGISEAQYHGKPMLSLP 387
              |.|.:     |:..|:  .::...|:.|..:|.|.:|..|::|.|...:.|....|..:|..|
plant   317 VVKKDPIPDGFEDRVSGR--GLVVRGWVSQLAVLRHVAVGGFLSHCGWNSVLEGITSGAVILGWP 379

  Fly   388 VFGDQPGNAHAMVK 401
            :..||..||..:|:
plant   380 MEADQFVNARLLVE 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A1NP_523607.2 GT1_Gtf-like 25..456 CDD:340817 92/461 (20%)
AT5G03490NP_195969.1 Glycosyltransferase_GTB_type 19..460 CDD:299143 91/455 (20%)
YjiC 19..447 CDD:224732 91/455 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.