DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A1 and UGT78D2

DIOPT Version :9

Sequence 1:NP_523607.2 Gene:Ugt37A1 / 35307 FlyBaseID:FBgn0026756 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_197207.1 Gene:UGT78D2 / 831568 AraportID:AT5G17050 Length:460 Species:Arabidopsis thaliana


Alignment Length:261 Identity:57/261 - (21%)
Similarity:101/261 - (38%) Gaps:67/261 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 KGMTFGQRLDSYISSLLYGIFLRQIDQRNRQYYNEIFGDDPTMPEYTDILRNTSLVFFCSHAASE 254
            :|:.|| .|||..|.:|:.:.| .:.:....:.|.....|||:   |:.||:....:        
plant   193 EGVVFG-NLDSVFSKMLHQMGL-ALPRATAVFINSFEDLDPTL---TNNLRSRFKRY-------- 244

  Fly   255 GPIRPSVPAAIEIGGIQIKDKPDPLPKNLEKFLGNATHGAIL-LSLGSNVQGSHIKADTV----- 313
                      :.||.:.:      |...|::.:.: .||.:. :...|:...::|...||     
plant   245 ----------LNIGPLGL------LSSTLQQLVQD-PHGCLAWMEKRSSGSVAYISFGTVMTPPP 292

  Fly   314 ---KKIFSVLSNLKQRVIWKWDD----------LDKTPGKSDNILYSRWLPQDDILAHPSVKLFI 365
               ..|...|.:.|...:|...:          ||:|  :...|:.. |.||.::|.|.:..:|:
plant   293 GELAAIAEGLESSKVPFVWSLKEKSLVQLPKGFLDRT--REQGIVVP-WAPQVELLKHEATGVFV 354

  Fly   366 NHAGKGGISEAQYHGKPMLSLPVFGDQPGNAHAM---------------VKSGFGLTLSLLTLEE 415
            .|.|...:.|:...|.||:..|.||||..|..|:               .|.||...|..:.:::
plant   355 THCGWNSVLESVSGGVPMICRPFFGDQRLNGRAVEVVWEIGMTIINGVFTKDGFEKCLDKVLVQD 419

  Fly   416 E 416
            :
plant   420 D 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A1NP_523607.2 GT1_Gtf-like 25..456 CDD:340817 57/261 (22%)
UGT78D2NP_197207.1 GT1_Gtf-like 12..438 CDD:340817 57/261 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.