DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A1 and AT5G17040

DIOPT Version :9

Sequence 1:NP_523607.2 Gene:Ugt37A1 / 35307 FlyBaseID:FBgn0026756 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_197206.2 Gene:AT5G17040 / 831567 AraportID:AT5G17040 Length:442 Species:Arabidopsis thaliana


Alignment Length:323 Identity:69/323 - (21%)
Similarity:123/323 - (38%) Gaps:84/323 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 SQMLNSLIGNPHDKVEKE-----------------KGMTFGQRLDSYISSLLYGIFLRQIDQRNR 219
            |.::::.|.:....:.||                 :|:.|| .|||..|.:|:.:.| .:.:...
plant   139 SLLISTQISSEKQSLSKETLGCISGMEKIRVKDTPEGVVFG-NLDSVFSKMLHQMGL-ALPRATT 201

  Fly   220 QYYNEIFGDDPTMPEYTDILRNTSLVFFCSHAASEGPIRPSVPAAIEIGGIQIKDKP--DP---- 278
            .|.|.....|||:   ||.||   |.|  ....|.||:      |:.....| ::.|  ||    
plant   202 VYMNSFEELDPTL---TDNLR---LKF--KRYLSIGPL------ALLFSTSQ-RETPLHDPHGCL 251

  Fly   279 --LPKNLEKFLGNATHGAILLSLGSNVQGSHIKADTVKKIFSVLSNLK-QRVIWKWDDLDKT--- 337
              :.|       .:|...:.::.|      .:......::..|...|: .:|.:.|...:|.   
plant   252 AWIKK-------RSTASVVYIAFG------RVMTPPPGELVVVAQGLESSKVPFVWSLQEKNMVH 303

  Fly   338 ------PGKSDNILYSRWLPQDDILAHPSVKLFINHAGKGGISEAQYHGKPMLSLPVFGDQPGNA 396
                  .|..:..:...|.||.::|.|.::.:|::|.|...:.|:...|.||:..|:|||...||
plant   304 LPKGFLDGTREQGMVVPWAPQVELLNHEAMGVFVSHGGWNSVLESVSAGVPMICRPIFGDHALNA 368

  Fly   397 HAM---------------VKSGFGLTLSLLTLEEE----PFRAAVLEILSNPKYSQRVVKFSS 440
            .::               .|.||..:|..:.::::    .|.|..|:.|:....|.....|.:
plant   369 RSVEAVWEIGMTISSGVFTKDGFEESLDRVLVQDDGKKMKFNAKKLKELAQEAVSTEGSSFEN 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A1NP_523607.2 GT1_Gtf-like 25..456 CDD:340817 69/323 (21%)
AT5G17040NP_197206.2 Glycosyltransferase_GTB_type 2..428 CDD:299143 68/318 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.