DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A1 and UGT78D3

DIOPT Version :9

Sequence 1:NP_523607.2 Gene:Ugt37A1 / 35307 FlyBaseID:FBgn0026756 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_197205.1 Gene:UGT78D3 / 831566 AraportID:AT5G17030 Length:459 Species:Arabidopsis thaliana


Alignment Length:444 Identity:85/444 - (19%)
Similarity:145/444 - (32%) Gaps:180/444 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 AKILAEQGHNVTVVTV-LEPTITHKNINLVTVPMTKEEIKQRSETIGAKQKNTSSNRFISILN-- 107
            |..:|..|...|.:|. |......:|:.:      ||..::..||||          |||.:.  
plant   135 ASWVAYYGGGATSLTAHLYTDAIRENVGV------KEVGERMEETIG----------FISGMEKI 183

  Fly   108 ---------MSGQMDSM----LRKMADVLKDQRVKELYLNKDNHFDLVISGYFMNDYQLGFARKV 159
                     :.|.:||:    |.:|...|  .|...:::|.....|..    |.||::..|.|.:
plant   184 RVKDTQEGVVFGNLDSVFSKTLHQMGLAL--PRATAVFINSFEELDPT----FTNDFRSEFKRYL 242

  Fly   160 N-APVVVLAPSPPSQMLNSLIGNPHD---KVEKEKGMTFGQRLDSYISSLLYGIFLRQIDQRNRQ 220
            | .|:.:|  |.||| .::|:.:||.   .:||                                
plant   243 NIGPLALL--SSPSQ-TSTLVHDPHGCLAWIEK-------------------------------- 272

  Fly   221 YYNEIFGDDPTMPEYTDILRNTSLVFFCSHAASEGPIRPSVPAAIEIGGIQIKDKPDPLPKNLEK 285
                               |:|:.|.:.:..      |.:.|..:|:..|               
plant   273 -------------------RSTASVAYIAFG------RVATPPPVELVAI--------------- 297

  Fly   286 FLGNATHGAILLSLGSNVQGSHIKADTVKKIFSVLSNLKQRVIWKWDD----------LDKTPGK 340
                             .||              |.:.|...:|...:          ||:|   
plant   298 -----------------AQG--------------LESSKVPFVWSLQEMKMTHLPEGFLDRT--- 328

  Fly   341 SDNILYSRWLPQDDILAHPSVKLFINHAGKGGISEAQYHGKPMLSLPVFGDQPGNAHAM------ 399
            .:..:...|.||.::|.|.::.:|::|.|...:.|:...|.||:..|:|||...||.::      
plant   329 REQGMVVPWAPQVELLNHEAMGVFVSHGGWNSVLESVSAGVPMICRPIFGDHAINARSVEAVWEI 393

  Fly   400 ---------VKSGFGLTLSLLTLEEE----PFRAAVLEILSNPKYSQRVVKFSS 440
                     .|.||..:|..:.::::    ...|..||.|:....|.:...|.:
plant   394 GVTISSGVFTKDGFEESLDRVLVQDDGKKMKVNAKKLEELAQEAVSTKGSSFEN 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A1NP_523607.2 GT1_Gtf-like 25..456 CDD:340817 85/444 (19%)
UGT78D3NP_197205.1 Glycosyltransferase_GTB_type 6..458 CDD:299143 85/444 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.