DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A1 and AT5G05900

DIOPT Version :9

Sequence 1:NP_523607.2 Gene:Ugt37A1 / 35307 FlyBaseID:FBgn0026756 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_196209.1 Gene:AT5G05900 / 830475 AraportID:AT5G05900 Length:450 Species:Arabidopsis thaliana


Alignment Length:451 Identity:85/451 - (18%)
Similarity:148/451 - (32%) Gaps:153/451 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 AQGANILGLFPSLSPSHLIISMSVAKILAEQGHNVTVVTV---LEPTITHKNINLVTVPMTKEEI 83
            :.|..:: |||......:...:.:||||..:|.::||:..   ......|.....:.:|....|.
plant     4 SNGLRVI-LFPLPLQGCINPMIQLAKILHSRGFSITVIHTRFNAPKASNHPLFTFLQIPDGLSET 67

  Fly    84 KQRSETIGAKQKNTSSNRFISILNMSGQMDSMLRKMADVL----------KDQRVKELYLNKDNH 138
            :.|:..|         ...:::||.|  .:|..|:....|          :.||:..|..:....
plant    68 ETRTHDI---------TLLLTLLNRS--CESPFRECLTKLLQSADSETGEEKQRISCLIDDSGWI 121

  Fly   139 FDLVISGYF------MNDYQLGFAR--------------------KVNAPVVVLAPSPPSQMLNS 177
            |...::..|      :|.|::.|.|                    :.:.||....|.....:|..
plant   122 FTQPVAQSFNLPRLVLNTYKVSFFRDHFVLPQLRREMYLPLQDSEQGDDPVEEFPPLRKKDLLQI 186

  Fly   178 LIGNPHDKVEKEKGMTFGQRLDSY----------ISSLLYGIFLRQIDQ----RNRQYY------ 222
            |        ::|     .::||||          .|.|::.....::||    :.|:.|      
plant   187 L--------DQE-----SEQLDSYSNMILETTKASSGLIFVSTCEELDQDSLSQAREDYQVPIFT 238

  Fly   223 ------------NEIFGDDPTMPEYTDILRNTSLVFFCSHAASEGPIRPSVPAAIEIGGIQIKDK 275
                        :.:|..|.|...:.|...:.|:::     .|.|.|.       .||..:..:.
plant   239 IGPSHSYFPGSSSSLFTVDETCIPWLDKQEDKSVIY-----VSFGSIS-------TIGEAEFMEI 291

  Fly   276 PDPLPKNLEKFL-----GNATHGAILLSLGSNVQGSHIKADTVKKIFSVLSNLKQRVIWKWDDLD 335
            ...|..:.:.||     |:..|||                                   :|.:..
plant   292 AWALRNSDQPFLWVVRGGSVVHGA-----------------------------------EWIEQL 321

  Fly   336 KTPGKSDNILYSRWLPQDDILAHPSVKLFINHAGKGGISEAQYHGKPMLSLPVFGDQPGNA 396
            ...||..|     |.||.::|.|.::..|:.|.|.....|:.:.|.||:.:|...||..||
plant   322 HEKGKIVN-----WAPQQEVLKHQAIGGFLTHNGWNSTVESVFEGVPMICMPFVWDQLLNA 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A1NP_523607.2 GT1_Gtf-like 25..456 CDD:340817 84/448 (19%)
AT5G05900NP_196209.1 Glycosyltransferase_GTB_type 2..447 CDD:299143 85/451 (19%)
YjiC 8..436 CDD:224732 84/447 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.