DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A1 and AT5G05890

DIOPT Version :9

Sequence 1:NP_523607.2 Gene:Ugt37A1 / 35307 FlyBaseID:FBgn0026756 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_196208.1 Gene:AT5G05890 / 830474 AraportID:AT5G05890 Length:455 Species:Arabidopsis thaliana


Alignment Length:484 Identity:91/484 - (18%)
Similarity:175/484 - (36%) Gaps:146/484 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 AQGANILGLFPSLSPSHLIISMSVAKILAEQGHNVTVVTV---LEPTITHKNINLVTVPMTKEEI 83
            :.|..:: |||......:...:.:||||..:|.::||:..   .....:|.....:.:|      
plant     4 SNGLRVI-LFPLPLQGCINPMIQLAKILHSRGFSITVIHTCFNAPKASSHPLFTFLEIP------ 61

  Fly    84 KQRSETIGAKQKNTSSNR-FISILNMSGQMD-----SMLRKMADV---LKDQRVKELYLNKDNHF 139
                :.:...:|.|::.: .:::||.:.:..     |.|.:.||.   .:.||:..|..:....|
plant    62 ----DGLSETEKRTNNTKLLLTLLNRNCESPFRECLSKLLQSADSETGEEKQRISCLIADSGWMF 122

  Fly   140 D-----------LVISGYFMNDYQLGFA-----RKVNAPVV------VLAPSPP----------- 171
            .           ||:|.:.::.::..|.     |:|..|:.      ::...||           
plant   123 TQPIAQSLKLPILVLSVFTVSFFRCQFVLPKLRREVYLPLQDSEQEDLVQEFPPLRKKDIVRILD 187

  Fly   172 --SQMLNSLIGNPHDKVEKEKGMTF--GQRLDSYISSLLYGIFLRQIDQRNRQYYNEIFGDDP-- 230
              :.:|:..:.......:...|:.|  .:.||.           ..:.|....:...|||..|  
plant   188 VETDILDPFLDKVLQMTKASSGLIFMSCEELDH-----------DSVSQAREDFKIPIFGIGPSH 241

  Fly   231 ----------TMPEYTDI----LRNTSLVFFCSHAA----SEGPIRPSVPAAIEIG-GIQIKDKP 276
                      :.|:.|.|    .:....|.:.|:.:    ||..:       |||. |::..|:|
plant   242 SHFPATSSSLSTPDETCIPWLDKQEDKSVIYVSYGSIVTISESDL-------IEIAWGLRNSDQP 299

  Fly   277 DPLPKNLEKFLGNATHGAILLSLGSNVQGSH----IKADTVKKIFSVLSNLKQRVIWKWDDLDKT 337
                     ||       :::.:|| |:|..    |..:.::|:     |.|.:::         
plant   300 ---------FL-------LVVRVGS-VRGREWIETIPEEIMEKL-----NEKGKIV--------- 333

  Fly   338 PGKSDNILYSRWLPQDDILAHPSVKLFINHAGKGGISEAQYHGKPMLSLPVFGDQPGNAHAMVKS 402
                      :|.||.|:|.|.::..|:.|.|.....|:.....||:.||...||..||. .|..
plant   334 ----------KWAPQQDVLKHRAIGGFLTHNGWSSTVESVCEAVPMICLPFRWDQMLNAR-FVSD 387

  Fly   403 GFGLTLSLL-TLEEEPFRAAVLEILSNPK 430
            .:.:.::|. .:|......|:..:|..|:
plant   388 VWMVGINLEDRVERNEIEGAIRRLLVEPE 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A1NP_523607.2 GT1_Gtf-like 25..456 CDD:340817 90/481 (19%)
AT5G05890NP_196208.1 Glycosyltransferase_GTB-type 2..455 CDD:385653 91/484 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.