DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A1 and AT5G05880

DIOPT Version :9

Sequence 1:NP_523607.2 Gene:Ugt37A1 / 35307 FlyBaseID:FBgn0026756 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_196207.1 Gene:AT5G05880 / 830473 AraportID:AT5G05880 Length:451 Species:Arabidopsis thaliana


Alignment Length:437 Identity:86/437 - (19%)
Similarity:151/437 - (34%) Gaps:124/437 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 AQGANILGLFPSLSPSHLIISMSVAKILAEQGHNVTVVTV---LEPTITHKNINLVTVPMTKEEI 83
            :.|..:: |||......:...:.:||||..:|.::||:..   .....:|.....:.:.....|.
plant     4 SNGLRVI-LFPLPLQGCINPMIQLAKILHSRGFSITVIHTCFNAPKASSHPLFTFIQIQDGLSET 67

  Fly    84 KQRSETIGAKQKNTSSNRFISILNMS--GQMDSMLRKMADVLKDQRVKELYLNKDNHF------- 139
            :.|:..:         ...|::||.:  ..:...|||:....|:::.:...|..|:.:       
plant    68 ETRTRDV---------KLLITLLNQNCESPVRECLRKLLQSAKEEKQRISCLINDSGWIFTQHLA 123

  Fly   140 -DLVISGYFMNDYQLGFAR-------------------KVNAPVVVLAPSPPSQML-----NSLI 179
             .|.:.....|.|::.|.|                   :.:.||....|.....:|     :|:.
plant   124 KSLNLMRLAFNTYKISFFRSHFVLPQLRREMFLPLQDSEQDDPVEKFPPLRKKDLLRILEADSVQ 188

  Fly   180 GNPHDKVEKEKGMTFGQRLDSYISSLLYGIFLRQIDQRNRQYYNEIFGDDPTMPEYTDILRNTSL 244
            |:.:..:..||         :..||.|..:...::||.:.....|.|    .:|.:         
plant   189 GDSYSDMILEK---------TKASSGLIFMSCEELDQDSLSQSREDF----KVPIF--------- 231

  Fly   245 VFFCSHAASEGPIRPSVPAAIEIGGIQIKDKPDP-----LPKNLEKFLGNATHGAILLSLGSNVQ 304
                    :.||.....||:     ......||.     |.:..:|       ..|.:|:||.|.
plant   232 --------AIGPSHSHFPAS-----SSSLFTPDETCIPWLDRQEDK-------SVIYVSIGSLVT 276

  Fly   305 GSHIKADTVKKIFSVLSNLKQRVIW----------KWDDLDKTP----------GKSDNILYSRW 349
               |....:.:|...|||..|..:|          :|  ::..|          ||     ..:|
plant   277 ---INETELMEIAWGLSNSDQPFLWVVRVGSVNGTEW--IEAIPEYFIKRLNEKGK-----IVKW 331

  Fly   350 LPQDDILAHPSVKLFINHAGKGGISEAQYHGKPMLSLPVFGDQPGNA 396
            .||.::|.|.::..|:.|.|.....|:...|.||:.||...||..||
plant   332 APQQEVLKHRAIGGFLTHNGWNSTVESVCEGVPMICLPFRWDQLLNA 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A1NP_523607.2 GT1_Gtf-like 25..456 CDD:340817 85/434 (20%)
AT5G05880NP_196207.1 Glycosyltransferase_GTB-type 2..451 CDD:385653 86/437 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.