DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A1 and UGT76C1

DIOPT Version :9

Sequence 1:NP_523607.2 Gene:Ugt37A1 / 35307 FlyBaseID:FBgn0026756 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_196206.1 Gene:UGT76C1 / 830472 AraportID:AT5G05870 Length:464 Species:Arabidopsis thaliana


Alignment Length:440 Identity:90/440 - (20%)
Similarity:144/440 - (32%) Gaps:139/440 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LFPSLSPSHLIISMSVAKILAEQGHNVTVVTVLEPTITHKNINLVTVPMTKE-------EIKQRS 87
            |||......:...:.:||||..:|.::|::        |...|   .|.:.:       :|:.  
plant    11 LFPLPLQGCINPMLQLAKILYSRGFSITII--------HTRFN---APKSSDHPLFTFLQIRD-- 62

  Fly    88 ETIGAKQKNTSSNRF---ISILNMSGQMD--SMLRKMADVLKDQRVKELYLNKDNHFDLVI--SG 145
               |..:..|.|...   :::||.:.|:.  ..|.|:.....|..      .:|.....||  ||
plant    63 ---GLSESQTQSRDLLLQLTLLNNNCQIPFRECLAKLIKPSSDSG------TEDRKISCVIDDSG 118

  Fly   146 YFMNDYQLGFARKVNAPVVVLA----------------------PSPPSQMLNSLIGNPHDKVEK 188
            :.   :....|...|.|..||.                      |.|.|: .:.|:.......:|
plant   119 WV---FTQSVAESFNLPRFVLCAYKFSFFLGHFLVPQIRREGFLPVPDSE-ADDLVPEFPPLRKK 179

  Fly   189 EKGMTFG-----QRLDSYISSLL------YGIFL---RQIDQRNRQYYNEIFGDDPTMPEYTDIL 239
            :.....|     :.||:|:..:|      .||.:   :::|..:....|::|             
plant   180 DLSRIMGTSAQSKPLDAYLLKILDATKPASGIIVMSCKELDHDSLAESNKVF------------- 231

  Fly   240 RNTSLVFFCSHAASEGPIRPSVPAAIEIGGIQIKDKPDPLPKNLEKFLG-------NATHGAILL 297
                                |:| ...||...|.|.|......||....       ..|...:.:
plant   232 --------------------SIP-IFPIGPFHIHDVPASSSSLLEPDQSCIPWLDMRETRSVVYV 275

  Fly   298 SLGSNVQGSHIKADTVKKIFSVLSNLKQRVIW----------KWDD------LDKTPGKSDNILY 346
            ||||.   :.:......:|...|.|..|..:|          .|.:      ::...||...:  
plant   276 SLGSI---ASLNESDFLEIACGLRNTNQSFLWVVRPGSVHGRDWIESLPSGFMESLDGKGKIV-- 335

  Fly   347 SRWLPQDDILAHPSVKLFINHAGKGGISEAQYHGKPMLSLPVFGDQPGNA 396
             ||.||.|:|||.:...|:.|.|.....|:...|.||:.||...||..||
plant   336 -RWAPQLDVLAHRATGGFLTHNGWNSTLESICEGVPMICLPCKWDQFVNA 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A1NP_523607.2 GT1_Gtf-like 25..456 CDD:340817 90/440 (20%)
UGT76C1NP_196206.1 Glycosyltransferase_GTB_type 2..451 CDD:299143 90/440 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.